Overview

  • Product name
  • Description
    Rabbit polyclonal to RKIP
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human RKIP aa 1-187.
    Sequence:

    MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRP TSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSG TVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFK VASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK


    Database link: P30086

  • Positive control
    • BT-474, 293T, 22RV-1, A549, PC-3, MCF-7, Mouse liver and Mouse brain extracts; Human thyroid cancer tissue; Rat liver tissue; HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab196832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 21 kDa.

Target

  • Function
    Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.
    HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.
  • Sequence similarities
    Belongs to the phosphatidylethanolamine-binding protein family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Epididymis luminal protein 210 antibody
    • Epididymis secretory protein Li 34 antibody
    • Epididymis secretory protein Li 96 antibody
    • HCNP antibody
    • HCNPpp antibody
    • HEL 210 antibody
    • HEL S 34 antibody
    • HEL S 96 antibody
    • Hippocampal cholinergic neurostimulating peptide antibody
    • Neuropolypeptide h3 antibody
    • PBP antibody
    • PEBP antibody
    • PEBP 1 antibody
    • PEBP-1 antibody
    • Pebp1 antibody
    • PEBP1_HUMAN antibody
    • Phosphatidylethanolamine binding protein antibody
    • Phosphatidylethanolamine binding protein 1 antibody
    • Prostatic binding protein antibody
    • Prostatic-binding protein antibody
    • R kip antibody
    • Raf kinase inhibitor protein antibody
    • Raf kinase inhibitory protein antibody
    • RKIP antibody
    see all

Images

  • All lanes : Anti-RKIP antibody (ab196832) at 1/500 dilution

    Lane 1 : BT-474 cell extract
    Lane 2 : 293T cell extract
    Lane 3 : 22RV-1 cell extract
    Lane 4 : A549 cell extract
    Lane 5 : PC-3 cell extract
    Lane 6 : MCF-7 cell extract
    Lane 7 : Mouse liver extract
    Lane 8 : Mouse brain extract

    Predicted band size: 21 kDa

  • Immunohistochemical analysis of paraffin-embedded Human thyroid cancer tissue labeling RKIP with ab196832 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Rat liver tissue labeling RKIP with ab196832 at 1/200 dilution.

  • Immunofluorescent analysis of HeLa cells labeling RKIP with ab196832 at 1/50 dilution. Blue: DAPI for nuclear staining.

References

ab196832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up