Overview

  • Product name
  • Description
    Rabbit polyclonal to RKIP
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human, Pig
    Predicted to work with: Cow, Dog, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human RKIP aa 2-187. (Expressed in E.coli).
    Sequence:

    PVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPT SISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGT VLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKV ASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK


    Database link: P30086

  • Positive control
    • IHC-P: Human kidney, liver, cerebrum, stomach, prostate and prostate cancer tissues. WB: Pig brain and liver tissue; HeLa and A549 cell lysate; Recombinant human RKIP protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 21 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function
    Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.
    HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.
  • Sequence similarities
    Belongs to the phosphatidylethanolamine-binding protein family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Epididymis luminal protein 210 antibody
    • Epididymis secretory protein Li 34 antibody
    • Epididymis secretory protein Li 96 antibody
    • HCNP antibody
    • HCNPpp antibody
    • HEL 210 antibody
    • HEL S 34 antibody
    • HEL S 96 antibody
    • Hippocampal cholinergic neurostimulating peptide antibody
    • Neuropolypeptide h3 antibody
    • PBP antibody
    • PEBP antibody
    • PEBP 1 antibody
    • PEBP-1 antibody
    • Pebp1 antibody
    • PEBP1_HUMAN antibody
    • Phosphatidylethanolamine binding protein antibody
    • Phosphatidylethanolamine binding protein 1 antibody
    • Prostatic binding protein antibody
    • Prostatic-binding protein antibody
    • R kip antibody
    • Raf kinase inhibitor protein antibody
    • Raf kinase inhibitory protein antibody
    • RKIP antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for RKIP using ab233144 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • Paraffin-embedded human prostate tissue stained for RKIP using ab233144 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • Paraffin-embedded human stomach tissue stained for RKIP using ab233144 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • Paraffin-embedded human cerebrum tissue stained for RKIP using ab233144 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • Paraffin-embedded human liver tissue stained for RKIP using ab233144 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • Paraffin-embedded human kidney tissue stained for RKIP using ab233144 at 20 µg/ml in immunohistochemical analysis. DAB staining. 

  • All lanes : Anti-RKIP antibody (ab233144) at 3 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : Pig liver lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 4 : A549 (Human lung carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 21 kDa

  • Anti-RKIP antibody (ab233144) at 3 µg/ml + Recombinant human RKIP protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 21 kDa

References

ab233144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up