Overview

  • Product name

    Anti-RLTPR antibody [EM53] (Phycoerythrin)
    See all RLTPR primary antibodies
  • Description

    Mouse monoclonal [EM53] to RLTPR (Phycoerythrin)
  • Host species

    Mouse
  • Conjugation

    Phycoerythrin. Ex: 488nm, Em: 575nm
  • Tested applications

    Suitable for: Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse RLTPR aa 1147-1397.
    Sequence:

    EAAVGTRPDKRRPLERGDTELAPSFEQRVQVMLQRIGVSRASGGAESKRK QSKDGEIKKAGSDGDIMDSSTETPPISIKSRTHSVSADPSCRPGPGGQGP ESATWKTLGQQLNAELRGRGWGQQDGPGPPSPCPSPSPRRTSPAPDILSL PEDPCLGPRNEDGQLRPRPLSAGRRAVSVHEDQLQAPAERPLRLQRSPVL KRRPKLEAPPSPSLGSGLGSKPLPPYPTEPSSPERSPPSPATDQRGGGPN P


    Database link: S0DHL8

  • Positive control

    • Flow Cytometry: RLTPR stable transfectants.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer

    Preservative: 0.0975% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Size exclusion
  • Clonality

    Monoclonal
  • Clone number

    EM53
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use at an assay dependent concentration.

Target

  • Tissue specificity

    Expressed in all tissues tested, including thymus, spleen, colon, leukocytes, peripheral blood, skin, skin keratinocytes and skin fibroblasts.
  • Sequence similarities

    Belongs to the CARMIL family.
    Contains 16 LRR (leucine-rich) repeats.
  • Developmental stage

    Expressed in fetal skin.
  • Information by UniProt
  • Database links

  • Alternative names

    • CARMIL2 antibody
    • CARMIL2b antibody
    • Leucine rich repeat containing 16C antibody
    • leucine-rich repeat antibody
    • Leucine-rich repeat-containing protein 16C antibody
    • LR16C_HUMAN antibody
    • LRRC16C antibody
    • RGD antibody
    • RGD leucine rich repeat tropomodulin and proline rich containing protein antibody
    • RGD motif leucine rich repeats tropomodulin domain and proline rich containing antibody
    • Rltpr antibody
    • tropomodulin and proline-rich-containing protein antibody
    see all

Images

  • Intracellular staining of RLTPR stable transfectants with ab232911.

    Recommended negative control: ab125926.

References

ab232911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up