Anti-RN-tre antibody (ab233414)
- Datasheet
- References (1)
- Protocols
Overview
-
Product name
Anti-RN-tre antibody
See all RN-tre primary antibodies -
Description
Rabbit polyclonal to RN-tre -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human RN-tre aa 1-292. Two N-terminal tags. Expressed in E.coli.
Sequence:MNSDQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYKVTDRFGF LHEEELPDHNVAVERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKG IPLQLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIRQIDLDVNR TFRDHIMFRDRYGVKQQSLFHVLAAYSIYNTEVGYCQGMSQITALLLMYM NEEDAFWALVKLFSGPKHAMHGFFVQGFPKLLRFQEHHEKILNKFLSKLK QHLDSQEIYTSFYTMKWFFQCFLDRTPFTLNLRIWDIYIFEG
Database link: Q92738 -
Positive control
- WB: Recombinant human RN-tre protein; Human lung lysate; Mouse stomach and spleen lysates. IHC-P: Human breast cancer, liver, prostate, cerebrum, colorectal cancer, brain and glioma tissue.
-
General notes
Previously labelled as USP6NL.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233414 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 94 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Acts as a GTPase-activating protein for RAB5A and RAB43. Involved in receptor trafficking. In complex with EPS8 inhibits internalization of EGFR. Involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for structural integrity of the Golgi complex. -
Tissue specificity
Widely expressed. -
Sequence similarities
Contains 1 Rab-GAP TBC domain. -
Cellular localization
Golgi apparatus. Cytoplasmic vesicle. - Information by UniProt
-
Database links
- Entrez Gene: 9712 Human
- Entrez Gene: 98910 Mouse
- Omim: 605405 Human
- SwissProt: Q92738 Human
- SwissProt: Q80XC3 Mouse
- Unigene: 498661 Human
- Unigene: 688100 Human
- Unigene: 40673 Mouse
-
Alternative names
- KIAA0019 antibody
- Related to the N terminus of tre antibody
- Related to the N-terminus of tre antibody
see all
Images
-
Anti-RN-tre antibody (ab233414) at 2 µg/ml + Recombinant human RN-tre protein
Predicted band size: 94 kDa -
Anti-RN-tre antibody (ab233414) at 2 µg/ml + Human lung tissue lysate
Predicted band size: 94 kDa -
Anti-RN-tre antibody (ab233414) at 2 µg/ml + Mouse stomach tissue lysate
Predicted band size: 94 kDa -
Anti-RN-tre antibody (ab233414) at 2 µg/ml + Mouse spleen tissue lysate
Predicted band size: 94 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RN-tre antibody (ab233414)
Formalin-fixed, paraffin-embedded human breast cancer tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RN-tre antibody (ab233414)
Formalin-fixed, paraffin-embedded human liver tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RN-tre antibody (ab233414)
Formalin-fixed, paraffin-embedded human prostate tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RN-tre antibody (ab233414)
Formalin-fixed, paraffin-embedded human cerebrum tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RN-tre antibody (ab233414)
Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RN-tre antibody (ab233414)
Formalin-fixed, paraffin-embedded human glioma tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RN-tre antibody (ab233414)
Formalin-fixed, paraffin-embedded human brain tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.
Datasheets and documents
References
This product has been referenced in:
- Sun K et al. Tre2 (USP6NL) promotes colorectal cancer cell proliferation via Wnt/ß-catenin pathway. Cancer Cell Int 19:102 (2019). Read more (PubMed: 31015802) »