Overview

  • Product name

  • Description

    Rabbit polyclonal to RN-tre
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human RN-tre aa 1-292. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    MNSDQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYKVTDRFGF LHEEELPDHNVAVERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKG IPLQLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIRQIDLDVNR TFRDHIMFRDRYGVKQQSLFHVLAAYSIYNTEVGYCQGMSQITALLLMYM NEEDAFWALVKLFSGPKHAMHGFFVQGFPKLLRFQEHHEKILNKFLSKLK QHLDSQEIYTSFYTMKWFFQCFLDRTPFTLNLRIWDIYIFEG


    Database link: Q92738

  • Positive control

    • WB: Recombinant human RN-tre protein; Human lung lysate; Mouse stomach and spleen lysates. IHC-P: Human breast cancer, liver, prostate, cerebrum, colorectal cancer, brain and glioma tissue.
  • General notes

    Previously labelled as USP6NL.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 94 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Acts as a GTPase-activating protein for RAB5A and RAB43. Involved in receptor trafficking. In complex with EPS8 inhibits internalization of EGFR. Involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for structural integrity of the Golgi complex.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 1 Rab-GAP TBC domain.
  • Cellular localization

    Golgi apparatus. Cytoplasmic vesicle.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0019 antibody
    • Related to the N terminus of tre antibody
    • Related to the N-terminus of tre antibody
    • RN tre antibody
    • RN-tre antibody
    • RNTRE antibody
    • TRE2NL antibody
    • US6NL_HUMAN antibody
    • USP6 N terminal like antibody
    • USP6 N terminal like protein antibody
    • USP6 N-terminal-like protein antibody
    • USP6NL antibody
    see all

Images

  • Anti-RN-tre antibody (ab233414) at 2 µg/ml + Recombinant human RN-tre protein

    Predicted band size: 94 kDa

  • Anti-RN-tre antibody (ab233414) at 2 µg/ml + Human lung tissue lysate

    Predicted band size: 94 kDa

  • Anti-RN-tre antibody (ab233414) at 2 µg/ml + Mouse stomach tissue lysate

    Predicted band size: 94 kDa

  • Anti-RN-tre antibody (ab233414) at 2 µg/ml + Mouse spleen tissue lysate

    Predicted band size: 94 kDa

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human brain tissue stained for RN-tre using ab233414 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

This product has been referenced in:

  • Sun K  et al. Tre2 (USP6NL) promotes colorectal cancer cell proliferation via Wnt/ß-catenin pathway. Cancer Cell Int 19:102 (2019). Read more (PubMed: 31015802) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233414.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up