Overview

  • Product name

    Anti-RNA polymerase II RPB11 antibody
    See all RNA polymerase II RPB11 primary antibodies
  • Description

    Rabbit polyclonal to RNA polymerase II RPB11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RNA polymerase II RPB11 aa 86-128.
    Sequence:

    VGWTLARVPRPGTALACFFGGPQGEAAVMEEQGLPPQAPGHVD


    Database link: F8WF84

  • Positive control

    • IHC-P: Human salivary gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab243465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft.
  • Tissue specificity

    Ubiquitously expressed. High expression was found in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the archaeal rpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA directed RNA polymerase II subunit RPB11 a antibody
    • DNA-directed RNA polymerase II 13.3 kDa polypeptide antibody
    • DNA-directed RNA polymerase II 13.3 kDa polypeptide antibody
    • DNA-directed RNA polymerase II subunit J 1 antibody
    • DNA-directed RNA polymerase II subunit J-1 antibody
    • DNA-directed RNA polymerase II subunit RPB11-a antibody
    • hRPB 14 antibody
    • hRPB14 antibody
    • POLR 2J1 antibody
    • POLR2J antibody
    • POLR2J1 antibody
    • polymerase (RNA) II (DNA directed) polypeptide J 13.3kDa antibody
    • polymerase (RNA) II (DNA directed) polypeptide J 13.3kDa antibody
    • RNA polymerase II 13.3 kDa subunit antibody
    • RNA polymerase II subunit B11 a antibody
    • RNA polymerase II subunit B11-a antibody
    • RPB 11 antibody
    • RPB 11A antibody
    • RPB 11m antibody
    • RPB11 antibody
    • RPB11_HUMAN antibody
    • RPB11a antibody
    • RPB11m antibody
    • Rpo2-4 antibody
    see all

Images

  • Paraffin-embedded human salivary gland tissue stained for RNA polymerase II RPB11 using ab243465 at 1/20 dilution in immunohistochemical analysis.

References

ab243465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up