Overview

  • Product name

    Anti-RNA polymerase II RPB4 antibody
    See all RNA polymerase II RPB4 primary antibodies
  • Description

    Rabbit polyclonal to RNA polymerase II RPB4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RNA polymerase II RPB4 aa 76-142.
    Sequence:

    NRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDE ELQQILDDIQTKRSFQY


    Database link: O15514

  • Positive control

    • ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB4 is part of a subcomplex with RPB7 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA.
  • Sequence similarities

    Belongs to the eukaryotic RPB4 RNA polymerase subunit family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA directed RNA polymerase II 16 kDa polypeptide antibody
    • DNA directed RNA polymerase II subunit D antibody
    • DNA directed RNA polymerase II subunit RPB4 antibody
    • DNA-directed RNA polymerase II 16 kDa polypeptide antibody
    • DNA-directed RNA polymerase II subunit D antibody
    • DNA-directed RNA polymerase II subunit rpb4 antibody
    • HSRBP4 antibody
    • HSRPB4 antibody
    • polr2d antibody
    • polymerase RNA II DNA directed polypeptide D antibody
    • RBP4 antibody
    • RNA polymerase II 16 kDa subunit antibody
    • RNA polymerase II subunit B4 antibody
    • RNA polymerase II subunit D antibody
    • RNA polymerase II subunit hsRBP4 antibody
    • RPB16 antibody
    • RPB4_HUMAN antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for RNA polymerase II RPB4 (green) using ab222073 at 4 µg/ml in ICC/IF.

References

ab222073 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222073.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up