Overview

  • Product name

  • Description

    Rabbit polyclonal to RNase 7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human RNase 7 aa 31-155. (Expressed in E.coli).
    Sequence:

    KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVA ATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSY VVACKPPQKKDSQQFHLVPVHLDRV


    Database link: Q9H1E1

  • Positive control

    • WB: Rat marrow tissue lysate; Recombinant human RNase 7 protein.
  • General notes

    Protein previously labeled as Ribonuclease 7.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Exhibits a potent RNase activity. Has broad-spectrum antimicrobial activity against many pathogenic microorganisms and remarkably potent activity (lethal dose of 90% < 30 nM) against a vancomycin resistant Enterococcus faecium.
  • Tissue specificity

    Expressed in various epithelial tissues including skin, respiratory tract, genito-urinary tract and, at a low level, in the gut. Expressed in liver, kidney, skeletal muscle and heart.
  • Sequence similarities

    Belongs to the pancreatic ribonuclease family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 3.1.27.- antibody
    • MGC133220 antibody
    • Ribonuclease 7 antibody
    • ribonuclease, RNase A family, 7 antibody
    • RNAS7_HUMAN antibody
    • RNase 7 antibody
    • RNASE7 antibody
    • SAP 2 antibody
    • SAP-2 antibody
    • Skin derived antimicrobial protein 2 antibody
    • Skin-derived antimicrobial protein 2 antibody
    see all

Images

  • Anti-RNase 7 antibody (ab233518) at 2 µg/ml + Rat marrow tissue lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Anti-RNase 7 antibody (ab233518) at 2 µg/ml + Recombinant human RNase 7 protein

References

ab233518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up