Overview

  • Product name

    Anti-RNase 7 antibody [CL0224]
    See all RNase 7 primary antibodies
  • Description

    Mouse monoclonal [CL0224] to RNase 7
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RNase 7 aa 31-155.
    Sequence:

    KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVA ATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSY VVACKPPQKKDSQQFHLVPVHLDRV

  • Positive control

    • Human skin, kidney and fallopian tube tissues; RNase 7 over-expression HEK293T lysate.
  • General notes

    Protein previously labeled as Ribonuclease 7.

Properties

Applications

Our Abpromise guarantee covers the use of ab154143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 17 kDa.

Target

  • Function

    Exhibits a potent RNase activity. Has broad-spectrum antimicrobial activity against many pathogenic microorganisms and remarkably potent activity (lethal dose of 90% < 30 nM) against a vancomycin resistant Enterococcus faecium.
  • Tissue specificity

    Expressed in various epithelial tissues including skin, respiratory tract, genito-urinary tract and, at a low level, in the gut. Expressed in liver, kidney, skeletal muscle and heart.
  • Sequence similarities

    Belongs to the pancreatic ribonuclease family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 3.1.27.- antibody
    • MGC133220 antibody
    • Ribonuclease 7 antibody
    • ribonuclease, RNase A family, 7 antibody
    • RNAS7_HUMAN antibody
    • RNase 7 antibody
    • RNASE7 antibody
    • SAP 2 antibody
    • SAP-2 antibody
    • Skin derived antimicrobial protein 2 antibody
    • Skin-derived antimicrobial protein 2 antibody
    see all

Images

  • Immunohistochemical analysis of Human skin tissue labeling RNase 7 with ab154143 at 1/50 dilution.

  • Immunohistochemical analysis of Human kidney tissue labeling RNase 7 with ab154143 at 1/50 dilution.

  • Immunohistochemical analysis of Human fallopian tube tissue labeling RNase 7 with ab154143 at 1/50 dilution.

References

This product has been referenced in:

  • Patra V  et al. Unique profile of antimicrobial peptide expression in polymorphic light eruption lesions compared to healthy skin, atopic dermatitis, and psoriasis. Photodermatol Photoimmunol Photomed 34:137-144 (2018). IHC-P ; Human . Read more (PubMed: 29044786) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab154143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up