Overview

  • Product name

  • Description

    Rabbit polyclonal to RNase L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RNase L aa 330-741.
    Sequence:

    HPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGI YLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGH LFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSC GYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVL YVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSD LLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSF DKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHK KMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDG AGGASGLASPGC


    Database link: Q05823

  • Positive control

    • IHC-P: Human tonsil and testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238159 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Endoribonuclease that functions in the interferon (IFN) antiviral response. In INF treated and virus infected cells, RNASEL probably mediates its antiviral effects through a combination of direct cleavage of single-stranded viral RNAs, inhibition of protein synthesis through the degradation of rRNA, induction of apoptosis, and induction of other antiviral genes. RNASEL mediated apoptosis is the result of a JNK-dependent stress-response pathway leading to cytochrome c release from mitochondria and caspase-dependent apoptosis. Therefore, activation of RNASEL could lead to elimination of virus infected cells under some circumstances. Might play a central role in the regulation of mRNA turnover.
  • Tissue specificity

    Highly expressed in spleen and thymus followed by prostate, testis, uterus, small intestine, colon and peripheral blood leukocytes.
  • Involvement in disease

    Prostate cancer, hereditary, 1 (HPC1) [MIM:601518]: A condition associated with familial predisposition to cancer of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the protein kinase superfamily.
    Contains 9 ANK repeats.
    Contains 1 KEN domain.
    Contains 1 protein kinase domain.
  • Domain

    The nine ankyrin repeats also called 2-5A sensor constitute the N-terminus 2-5A binding domain.
    The protein kinase domain is predicted to be catalytically inactive. It allows the homodimerization.
    The ribonuclease domain is located in the C-terminus. A single active nuclease domain in a dimer is sufficient for ribonuclease activity.
  • Cellular localization

    Cytoplasm. Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2 5A dependent ribonuclease antibody
    • 2 5A dependent RNase antibody
    • 2' 5' oligoisoadenylate synthetase dependent antibody
    • 2-5A-dependent ribonuclease antibody
    • 2-5A-dependent RNase antibody
    • DKFZp781D08126 antibody
    • Interferon induced 2 5A dependent RNase antibody
    • MGC104972 antibody
    • MGC133329 antibody
    • PRCA 1 antibody
    • PRCA1 antibody
    • Ribonuclease 4 antibody
    • Ribonuclease L (2' 5' oligoisoadenylate synthetase dependent) antibody
    • Ribonuclease L antibody
    • Ribonuclease4 antibody
    • RibonucleaseL antibody
    • RN5A_HUMAN antibody
    • RNase L antibody
    • Rnasel antibody
    • RNS 4 antibody
    • RNS4 antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for RNase L using ab238159 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for RNase L using ab238159 at 1/100 dilution in immunohistochemical analysis.

References

ab238159 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238159.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up