Overview

  • Product name

    Anti-RNASE11 antibody
  • Description

    Rabbit polyclonal to RNASE11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
    Predicted to work with: Sheep, Goat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Cow RNASE11 aa 31-150. N-terminal tag. Expressed in E. coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-AAKFERQHMDSST SAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKN GQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVP VHFDASV


    Database link: P61823

  • Positive control

    • WB: Recombinant Cow RNASE11 protein. Cow pancreas lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 16 kDa.

Target

  • Relevance

    RNASE11 belongs to the pancreatic ribonuclease family.
  • Cellular localization

    Secreted
  • Alternative names

    • C14orf6 antibody
    • Probable ribonuclease 11 antibody
    • Ribonuclease 11 antibody
    • ribonuclease, RNase A family, 11 (non-active) antibody
    • RNase 11 antibody
    • RNASE11 antibody
    • RNS11_HUMAN antibody
    • UNQ5832/PRO19669 antibody
    see all

Images

  • Anti-RNASE11 antibody (ab231619) at 2 µg/ml + Recombinant bovine RNASE11 protein

    Predicted band size: 16 kDa

  • Anti-RNASE11 antibody (ab231619) at 2 µg/ml + Bovine pancreas lysate

    Predicted band size: 16 kDa

References

ab231619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up