Overview

  • Product name

  • Description

    Rabbit polyclonal to RNASE4
  • Host species

    Rabbit
  • Specificity

    ab200717 detects endogenous levels of RNASE4.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Pig, Chimpanzee, Orangutan
  • Immunogen

    Synthetic peptide within Human RNASE4 aa 54-99. The exact sequence is proprietary.
    Sequence:

    NLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNC


    Database link: P34096

  • Positive control

    • HEK293T, sp2/0 and PC12 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.1% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab200717 was affinity-purified from Rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is >95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 17 kDa.

Target

Images

  • All lanes : Anti-RNASE4 antibody (ab200717) at 1/500 dilution

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : sp2/0 whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 17 kDa

References

This product has been referenced in:

  • Murtha MJ  et al. Insulin receptor signaling regulates renal collecting duct and intercalated cell antibacterial defenses. J Clin Invest 128:5634-5646 (2018). Read more (PubMed: 30418175) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up