Overview

  • Product name

  • Description

    Rabbit polyclonal to RND1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human RND1 aa 127-179.
    Sequence:

    TDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSI HSI


    Database link: Q92730

  • Positive control

    • ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Lacks intrinsic GTPase activity. Has a low affinity for GDP, and constitutively binds GTP. Controls rearrangements of the actin cytoskeleton. Induces the Rac-dependent neuritic process formation in part by disruption of the cortical actin filaments. Causes the formation of many neuritic processes from the cell body with disruption of the cortical actin filaments.
  • Tissue specificity

    Mostly expressed in brain and liver.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization

    Cell membrane. Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHS antibody
    • FLJ42294 antibody
    • GTP binding protein RHO6 antibody
    • Ras homolog gene family member S antibody
    • RHO 6 antibody
    • Rho family GTPase 1 antibody
    • Rho related GTP binding protein Rho6 antibody
    • RHO S antibody
    • Rho-related GTP-binding protein Rho6 antibody
    • RHO6 antibody
    • RHOS antibody
    • RND 1 antibody
    • Rnd1 antibody
    • RND1_HUMAN antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A549 (human lung carcinoma cell line) cells stained for RND1 (green) using ab222331 at 4 µg/ml in ICC/IF.

References

ab222331 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222331.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up