Overview

  • Product name

  • Description

    Rabbit polyclonal to RND2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human RND2 aa 176-221. The exact sequence is proprietary.
    Sequence:

    VATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRA


    Database link: P52198

  • Positive control

    • HEK293T, sp2/0 and PC12 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab200713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 25 kDa.

Target

  • Function

    May be specifically involved in neuronal and hepatic functions. Is a C3 toxin-insensitive member of the Rho subfamily.
  • Tissue specificity

    Highly expressed in testis.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle > acrosome membrane. Colocalizes with RACGAP1 in Golgi-derived proacrosomal vesicles and the acrosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHN antibody
    • CTD-3199J23.4 antibody
    • GTP-binding protein Rho7 antibody
    • ras homolog gene family, member N antibody
    • Rho 7 antibody
    • Rho family GTPase 2 antibody
    • Rho N antibody
    • Rho related GTP-binding protein RhoN antibody
    • Rho-related GTP-binding protein Rho7 antibody
    • Rho-related GTP-binding protein RhoN antibody
    • Rho7 antibody
    • RhoN antibody
    • Rnd 2 antibody
    • Rnd2 antibody
    • RND2_HUMAN antibody
    see all

Images

  • All lanes : Anti-RND2 antibody (ab200713) at 1/500 dilution

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : sp2/0 whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 25 kDa

References

ab200713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up