Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human RNF11 aa 1-154.
    Sequence:

    MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYH PTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECV ICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSS YETN


    Database link: Q9Y3C5

  • Positive control

    • IHC-P: Human colon cancer and thyroid tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab239023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome.
  • Tissue specificity

    Expressed at low levels in the lung, liver, kidney, pancreas, spleen, prostate, thymus, ovary, small intestine, colon, and peripheral blood lymphocytes, and, at intermediate levels, in the testis, heart, brain and placenta. Highest expression in the skeletal muscle. In the brain, expressed at different levels in several regions: high levels in the amygdala, moderate in the hippocampus and thalamus, low in the caudate and extremely low levels in the corpus callosum (at protein level). Restricted to neurons, enriched in somatodendritic compartments and excluded from white matter (at protein level). In substantia nigra, present in cell bodies and processes of dopaminergic and nondopaminergic cells (at protein level). In Parkinson disease, sequestered in Lewy bodies and neurites. Overexpressed in breast cancer cells, but not detected in the surrounding stroma and weakly, if at all, in normal breast epithelial cells (at protein level). Also expressed in several tumor cell lines.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
  • Domain

    The WW-binding motif mediates interaction with NEDD4.
  • Post-translational
    modifications

    Ubiquitinated in the presence of SMURF2 and UBE2D1, as well as WWP1.
    Phosphorylation by PKB/AKT1 may accelerate degradation by the proteasome.
  • Cellular localization

    Cytoplasm. Nucleus. Predominantly cytoplasmic, when unphosphorylated, and nuclear, when phosphorylated by PKB/AKT1.
  • Information by UniProt
  • Database links

  • Alternative names

    • CGI 123 antibody
    • RING finger protein 11 antibody
    • RNF11 antibody
    • RNF11_HUMAN antibody
    • Sid 1669 antibody
    • SID1669 antibody
    see all

Images

  • Paraffin-embedded human thyroid tissue stained for RNF11 with ab239023 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for RNF11 with ab239023 at 1/100 dilution in immunohistochemical analysis.

References

ab239023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up