Overview

  • Product name

    Anti-RNF12 antibody
  • Description

    Rabbit polyclonal to RNF12
  • Host species

    Rabbit
  • Specificity

    ab22813 recognises RNF12.
  • Tested applications

    Suitable for: IHC-P, WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    Synthetic peptide within Human RNF12 aa 532-581 (internal sequence). The exact sequence is proprietary.
    Sequence:

    AQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGN


    Database link: Q9NVW2

  • Positive control

    • Jurkat whole cell lysate (ab7899) and Human spermatophore tissue sections.

Properties

Applications

Our Abpromise guarantee covers the use of ab22813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 69 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/12500.

Target

  • Function

    E3 ubiquitin-protein ligase. Acts as a negative coregulator for LIM homeodomain transcription factors by mediating the ubiquitination and subsequent degradation of LIM cofactors LDB1 and LDB2 and by mediating the recruitment the SIN3a/histone deacetylase corepressor complex. Ubiquitination and degradation of LIM cofactors LDB1 and LDB2 allows DNA-bound LIM homeodomain transcription factors to interact with other protein partners such as RLIM. Plays a role in telomere length-mediated growth suppression by mediating the ubiquitination and degradation of TERF1. By targeting ZFP42 for degradation, acts as an activator of random inactivation of X chromosome in the embryo, a stochastic process in which one X chromosome is inactivated to minimize sex-related dosage differences of X-encoded genes in somatic cells of female placental mammals.
  • Tissue specificity

    Expressed in many tissues.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the RNF12 family.
    Contains 1 RING-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin-protein ligase RLIM antibody
    • LIM domain-interacting RING finger protein antibody
    • R-LIM antibody
    • Renal carcinoma antigen NY-REN-43 antibody
    • RING finger LIM domain-binding protein antibody
    • RING finger protein 12 antibody
    • RLIM antibody
    • RNF12 antibody
    • RNF12_HUMAN antibody
    see all

Images

  • ab22813 used at 4-8 µg/ml on parffin embeded tissue: Human spermatophore cells with positive label: Epithelial cells (indicated with arrows)
  • Anti-RNF12 antibody (ab22813) at 1 µg/ml + Jurkat cell lysate

    Developed using the ECL technique.

    Predicted band size: 69 kDa
    Observed band size: 60 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 52 kDa. We are unsure as to the identity of these extra bands.

References

ab22813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab22813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up