Overview

  • Product name

    Anti-RNF123 antibody
  • Description

    Rabbit polyclonal to RNF123
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RNF123 aa 699-782.
    Sequence:

    LSTSEKVKVRTLSVEQRTREDIEGSHWNEGLLLGRPPEEPEQPLTENSLL EVLDGAVMMYNLSVHQQLGKMVGVSDDVNEYAMA


    Database link: Q5XPI4

  • Positive control

    • ICC/IF: PC-3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Catalytic subunit of the KPC complex that acts as E3 ubiquitin-protein ligase. Required for poly-ubiquitination and proteasome-mediated degradation of CDKN1B during G1 phase of the cell cycle.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications

    Ubiquitinated, leading to its degradation. Deubiquitinated by USP19, thereby stimulating CDKN1B ubiquitin-dependent degradation.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686C2222 antibody
    • E3 ubiquitin protein ligase RNF123 antibody
    • E3 ubiquitin-protein ligase RNF123 antibody
    • FLJ12565 antibody
    • FP1477 antibody
    • Kip1 ubiquitination promoting complex protein 1 antibody
    • Kip1 ubiquitination-promoting complex protein 1 antibody
    • KPC 1 antibody
    • KPC1 antibody
    • MGC163504 antibody
    • RING finger protein 123 antibody
    • RN123_HUMAN antibody
    • RNF 123 antibody
    • Rnf123 antibody
    • Ubiquitin ligase antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized PC-3 (human prostate cancer cell line) cells stained for RNF123 (green) using ab221877 at 4 ug/ml in ICC/IF.

References

ab221877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up