Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF125
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human RNF125 aa 131-180. NCBI Accession No. NP_060301.2.
    Sequence:

    ELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDEN


    Database link: Q96EQ8

  • Positive control

    • Human thymus and small intestine tissues; K562 and HT29 cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab211450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 26 kDa.
ELISA 1/10000.

Target

  • Relevance

    RNF125 is a novel E3 ubiquitin ligase that is expressed in CD4 and CD8 positive T cells and contains an N-terminal RING finger domain. It may function as a positive regulator in the T-cell receptor signaling pathway. E3 ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins.
  • Database links

  • Alternative names

    • E3 ubiquitin protein ligase RNF125 antibody
    • Ring finger protein 125 antibody
    • RNF 125 antibody
    • T cell RING activation protein 1 antibody
    • T cell ring protein identified in activation screen antibody
    • TRAC 1 antibody
    see all

Images

  • All lanes : Anti-RNF125 antibody (ab211450) at 1/500 dilution

    Lane 1 : K562 cell extract
    Lane 2 : HT29 cell extract
    Lane 3 : K562 cell extract with synthesized RNF125 peptide

    Predicted band size: 26 kDa

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human thymus tissue labeling RNF125 with ab211450 at 5μg/mL. 

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human small intestine tissue labeling RNF125 with ab211450 at 5ug/mL. 

References

ab211450 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up