Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF126
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human RNF126 aa 39-225.
    Sequence:

    ELPEETRSTENGSAPSTAPTDQSRPPLEHVDQHLFTLPQGYGQFAFGIFD DSFEIPTFPPGAQADDGRDPESRRERDHPSRHRYGARQPRARLTTRRATG RHEGVPTLEGIIQQLVNGIITPATIPSLGPWGVLHSNPMDYAWGANGLDA IITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGS


    Database link: Q9BV68

  • Positive control

    • WB: Mouse brain tissue lysate. IHC-P: Human testis and pancreatic tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 36 kDa (predicted molecular weight: 36 kDa).
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    E3 ubiquitin-protein ligase. By ubiquitinating CDKN1A/p21 and targeting it for proteasomal degradation, may promote cell proliferation.
  • Tissue specificity

    Highly expressed in liver and testis.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications

    Auto-ubiquitinated.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin-protein ligase RNF126 antibody
    • FLJ20552 antibody
    • MGC1022 antibody
    • MGC14317 antibody
    • RING finger protein 126 antibody
    • RN126_HUMAN antibody
    • RNF 126 antibody
    • RNF126 antibody
    see all

Images

  • Anti-RNF126 antibody (ab234812) at 1/500 dilution + Mouse brain lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 36 kDa
    Observed band size: 36 kDa

  • Paraffin-embedded human testis tissue stained for RNF126 using ab234812 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic tissue stained for RNF126 using ab234812 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling RNF126 using ab234812 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

References

ab234812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up