Overview

  • Product name

    Anti-RNF128/GRAIL antibody
    See all RNF128/GRAIL primary antibodies
  • Description

    Rabbit polyclonal to RNF128/GRAIL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human RNF128/GRAIL aa 229-400.
    Sequence:

    YSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCA VCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIE VDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLE EHVQSTNESLQLVNHEANSVAV


    Database link: Q8TEB7

  • Positive control

    • WB: Mouse liver tissue lysate. ICC/IF: HepG2 cells.
  • General notes

    Previously labelled as RNF128. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237684 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 47 kDa.

Target

  • Function

    E3 ubiquitin-protein ligase that catalyzes polyubiquitin chains. Functions as an inhibitor of cytokine gene transcription. Inhibits IL2 and IL4 transcription and this activity is likely to be mediated by E3 ligase activity. Plays an important role in the induction of the anergic phenotype. Functions in the patterning of the dorsal ectoderm; sensitizes ectoderm to respond to neural-inducing signals.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 PA (protease associated) domain.
    Contains 1 RING-type zinc finger.
  • Domain

    Binding to E2 ubiquitin-conjugating enzyme requires an intact RING finger domain.
  • Post-translational
    modifications

    Auto-ubiquitinated. Controls the development of T cell clonal anergy by ubiquitination.
  • Cellular localization

    Endomembrane system. Cytoplasm > perinuclear region. Localized in an asymmetric perinuclear punctate manner. Localizes to the internal pool of the transferrin recycling endosomal pathway. Partially colocalized with the endoplasmic reticulum resident HSPA5, with Golgi resident STX5, and with the late endosomal GTPase RAB7.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin protein ligase RNF128 antibody
    • E3 ubiquitin-protein ligase RNF128 antibody
    • FLJ23516 antibody
    • Gene related to anergy in lymphocytes protein antibody
    • GRAIL antibody
    • RING finger protein 128 antibody
    • RN128_HUMAN antibody
    • RNF128 antibody
    see all

Images

  • Anti-RNF128/GRAIL antibody (ab237684) at 1/1000 dilution + Mouse liver tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 47 kDa

  • HepG2 (human epithelial cell line from cervix adenocarcinoma) cells stained for RNF128/GRAIL (green) using ab237684 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

References

ab237684 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237684.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up