Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF135
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RNF135 aa 339-432.
    Sequence:

    VLGRTMDSCCVEWKGTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLA FYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV


    Database link: Q8IUD6

  • Positive control

    • WB: HEK-293T and Jurkat whole cell lysates. IHC-P: Human gastric cancer and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 48 kDa (predicted molecular weight: 48 kDa).

Target

  • Function

    Acts as an E2-dependent E3 ubiquitin-protein ligase, involved in innate immune defense against viruses. Ubiquitinates DDX58 and is required for full activation of the DDX58 signaling resulting in interferon beta production.
  • Tissue specificity

    Expressed in skeletal muscle, spleen, kidney, placenta, prostate, stomach, thyroid and tongue. Also weakly expressed in heart, thymus, liver and lung.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Defects in RNF135 are the cause of macrocephaly macrosomia facial dysmorphism syndrome (MMFD) [MIM:614192]. MMFD is an autosomal dominant disorder characterized by the association of macrothrombocytopathy and progressive sensorineural hearing loss without renal dysfunction.
  • Sequence similarities

    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin-protein ligase RNF135 antibody
    • L13 antibody
    • MGC13061 antibody
    • MMFD antibody
    • REUL antibody
    • RIG-I E3 ubiquitin ligase antibody
    • RING finger protein 135 antibody
    • Riplet antibody
    • RN135_HUMAN antibody
    • Rnf135 antibody
    see all

Images

  • All lanes : Anti-RNF135 antibody (ab229959) at 1/1000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 48 kDa
    Observed band size: 48 kDa

  • Paraffin-embedded human gastric cancer tissue stained for RNF135 using ab229959 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for RNF135 using ab229959 at 1/100 dilution in immunohistochemical analysis.

References

ab229959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up