Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF135
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human RNF135 aa 199-248 (internal sequence). The exact sequence is proprietary.
    Sequence:

    DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPAL


    Database link: Q8IUD6

  • Positive control

    • Jurkat Cell Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab28636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Detects a band of approximately 48 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/62500.

Target

  • Function

    Acts as an E2-dependent E3 ubiquitin-protein ligase, involved in innate immune defense against viruses. Ubiquitinates DDX58 and is required for full activation of the DDX58 signaling resulting in interferon beta production.
  • Tissue specificity

    Expressed in skeletal muscle, spleen, kidney, placenta, prostate, stomach, thyroid and tongue. Also weakly expressed in heart, thymus, liver and lung.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Defects in RNF135 are the cause of macrocephaly macrosomia facial dysmorphism syndrome (MMFD) [MIM:614192]. MMFD is an autosomal dominant disorder characterized by the association of macrothrombocytopathy and progressive sensorineural hearing loss without renal dysfunction.
  • Sequence similarities

    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin-protein ligase RNF135 antibody
    • L13 antibody
    • MGC13061 antibody
    • MMFD antibody
    • REUL antibody
    • RIG-I E3 ubiquitin ligase antibody
    • RING finger protein 135 antibody
    • Riplet antibody
    • RN135_HUMAN antibody
    • Rnf135 antibody
    see all

Images

References

This product has been referenced in:

  • Lee W  et al. Vibrio vulnificus quorum-sensing molecule cyclo(Phe-Pro) inhibits RIG-I-mediated antiviral innate immunity. Nat Commun 9:1606 (2018). Read more (PubMed: 29686409) »
  • Hu J  et al. A common polymorphism in the caspase recruitment domain of RIG-I modifies the innate immune response of human dendritic cells. J Immunol 185:424-32 (2010). WB ; Human . Read more (PubMed: 20511549) »
See all 2 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Loading amount
50 µg
Gel Running Conditions
Reduced Denaturing (10%)
Sample
Human Cell lysate - whole cell (liver carcinoma cell line)
Specification
liver carcinoma cell line
Blocking step
BSA as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Oct 29 2014

Application
Western blot
Sample
Human Cell lysate - whole cell (fibroblasts)
Loading amount
50 µg
Specification
fibroblasts
Treatment
Different siRNA sequences for RNF135
Gel Running Conditions
Reduced Denaturing (12%)
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2.5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Oct 11 2011

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (U2OS)
Specification
U2OS
Fixative
Paraformaldehyde
Permeabilization
Yes - 0.5% triton 10min

Abcam user community

Verified customer

Submitted Oct 10 2011

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up