Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF160
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RNF160 aa 939-1018.
    Sequence:

    LMGVYIGSVMPNDSEWEKMRQSLPMQWLHRPLLEGRLSLNYECFKTDFKE QDIKTLPSHLCTSALLSKMVLIALRKETVL


    Database link: O94822

  • Positive control

    • IHC-P: Human breast tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224474 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    RNF160 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
  • Database links

  • Alternative names

    • C21orf10 antibody
    • C21orf98 antibody
    • E3 ubiquitin protein ligase listerin antibody
    • HSPC087 antibody
    • Kiaa0714 antibody
    • Lister antibody
    • Listerin E3 ubiquitin protein ligase 1 antibody
    • Ring finger protein 160 antibody
    • Zinc finger protein 294 antibody
    • ZNF294 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for RNF160 (green) using ab224474 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human breast tissue stained for RNF160 with ab224474 at 1/20 dilution in immunohistochemical analysis.

References

ab224474 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224474.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up