Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF168
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RNF168 aa 229-323.
    Sequence:

    LTPKSQFGSASHSEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLS PQISLGVGEQGADSSIESPMPWLCACGAEWYHEGNVKTRPSNHGK


    Database link: Q8IYW5

  • Positive control

    • MCF7 cells; RT-4 and U-251 MG cell lysates; Human plasma; Human liver and tonsil lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab220324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/500 - 1/1000. Predicted molecular weight: 65 kDa.

Target

  • Function

    E3 ubiquitin-protein ligase required for accumulation of repair proteins to sites of DNA damage. Acts with UBE2N/UBC13 to amplify the RNF8-dependent histone ubiquitination. Recruited to sites of DNA damage at double-strand breaks (DSBs) by binding to ubiquitinated histone H2A and ubiquitinates histone H2A and H2AX, leading to amplify the RNF8-dependent H2A ubiquitination and promoting the formation of 'Lys-63'-linked ubiquitin conjugates. This leads to concentrate ubiquitinated histones H2A and H2AX at DNA lesions to the threshold required for recruitment of TP53BP1 and BRCA1.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Defects in RNF168 are the cause of Riddle syndrome (RIDDLES) [MIM:611943]. Riddle syndrome is characterized by increased radiosensitivity, immunodeficiency, mild motor control and learning difficulties, facial dysmorphism, and short stature. Defects are probably due to impaired localization of TP53BP1 and BRCA1 at DNA lesions.
  • Sequence similarities

    Belongs to the RNF168 family.
    Contains 1 RING-type zinc finger.
  • Domain

    The MIU motifs (motif interacting with ubiquitin) mediate the interaction with ubiquitin and the localization at sites of DNA damage.
  • Cellular localization

    Nucleus. Localizes to sites of DNA damage.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin protein ligase RNF168 antibody
    • E3 ubiquitin-protein ligase RNF168 antibody
    • FLJ35794 antibody
    • FLJ39749 antibody
    • hRNF168 antibody
    • RING finger protein 168 antibody
    • RN168_HUMAN antibody
    • RNF 168 antibody
    • Rnf168 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling RNF168 with ab220324 at 4 μg/ml (green).

  • All lanes : Anti-RNF168 antibody (ab220324) at 1/500 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 65 kDa

References

ab220324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Human Cell lysate - whole cell (HeLa)
Gel Running Conditions
Reduced Denaturing (10)
Loading amount
20 µg
Specification
HeLa
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jan 04 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up