Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF168
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RNF168 aa 194-296.
    Sequence:

    ISASPLNSRKSDPVTPKSEKKSKNKQRNTGDIQKYLTPKSQFGSASHSEA VQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQISLGVGEQGADSS IES


    Database link: Q8IYW5

  • Positive control

    • IHC-P: Human prostate cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.

Target

  • Function

    E3 ubiquitin-protein ligase required for accumulation of repair proteins to sites of DNA damage. Acts with UBE2N/UBC13 to amplify the RNF8-dependent histone ubiquitination. Recruited to sites of DNA damage at double-strand breaks (DSBs) by binding to ubiquitinated histone H2A and ubiquitinates histone H2A and H2AX, leading to amplify the RNF8-dependent H2A ubiquitination and promoting the formation of 'Lys-63'-linked ubiquitin conjugates. This leads to concentrate ubiquitinated histones H2A and H2AX at DNA lesions to the threshold required for recruitment of TP53BP1 and BRCA1.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Defects in RNF168 are the cause of Riddle syndrome (RIDDLES) [MIM:611943]. Riddle syndrome is characterized by increased radiosensitivity, immunodeficiency, mild motor control and learning difficulties, facial dysmorphism, and short stature. Defects are probably due to impaired localization of TP53BP1 and BRCA1 at DNA lesions.
  • Sequence similarities

    Belongs to the RNF168 family.
    Contains 1 RING-type zinc finger.
  • Domain

    The MIU motifs (motif interacting with ubiquitin) mediate the interaction with ubiquitin and the localization at sites of DNA damage.
  • Cellular localization

    Nucleus. Localizes to sites of DNA damage.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin protein ligase RNF168 antibody
    • E3 ubiquitin-protein ligase RNF168 antibody
    • FLJ35794 antibody
    • FLJ39749 antibody
    • hRNF168 antibody
    • RING finger protein 168 antibody
    • RN168_HUMAN antibody
    • RNF 168 antibody
    • Rnf168 antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for RNF168 using ab235892 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab235892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up