Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF17
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human RNF17.
    Sequence:

    SYEIGYILKDNSQKHIEVWDPSPEEIISNEVHNLNPVSAKSLPNENFQSL YNKELPVHICNVISPEKIYVQWLLTENLLNSLEEKMIAAYENSKWEPVK


    Database link: Q9BXT8

  • Positive control

    • IHC-P: Human stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243819 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    RNF17 (Ring finger protein 17) is required for differentiation of male germ cells.
  • Database links

  • Alternative names

    • FLJ11045 antibody
    • Mmip 2 antibody
    • Mmip2 antibody
    • OTTHUMP00000018139 antibody
    • OTTHUMP00000042342 antibody
    • Ring finger protein 17 antibody
    • RNF 17 antibody
    • SPATA 23 antibody
    • SPATA23 antibody
    • Spermatogenesis associated 23 antibody
    • TDRD 4 antibody
    • TDRD4 antibody
    • Tudor domain containing 4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for RNF17 with ab243819 at a 1/50 dilution in immunohistochemical analysis.

References

ab243819 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243819.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up