Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF183
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human RNF183 aa 6-151. (BC013036)
    Sequence:

    GELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLC PLCRQPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKS RYFLRQPRVYTLDLGPQPGGQTGPPPDTASATVSTPILIPSHHSL


    Database link: Q96D59

  • Positive control

    • HepG2 cell lysate

Properties

  • Form

    Lyophilised:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 22 kDa.

Target

Images

  • Anti-RNF183 antibody (ab197321) at 1/1000 dilution + HepG2 cell lysate

    Predicted band size: 22 kDa

References

This product has been referenced in:

  • Geng R  et al. Synthetic lethal short hairpin RNA screening reveals that ring finger protein 183 confers resistance to trametinib in colorectal cancer cells. Chin J Cancer 36:63 (2017). Read more (PubMed: 28756770) »
  • Geng R  et al. RNF183 promotes proliferation and metastasis of colorectal cancer cells via activation of NF-?B-IL-8 axis. Cell Death Dis 8:e2994 (2017). Read more (PubMed: 28796265) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up