Overview

  • Product name

    Anti-RNF19B antibody
  • Description

    Rabbit polyclonal to RNF19B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human RNF19B aa 279-328 (internal sequence). The exact sequence is proprietary.
    Sequence:

    GRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGIGVPIMLA


    Database link: Q6ZMZ0-3

  • Positive control

    • Jurkat whole cell lysate (ab7899).

Properties

Applications

Our Abpromise guarantee covers the use of ab186483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa.

Target

  • Function

    E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates, such as UCKL1. Involved in the cytolytic activity of natural killer cells and cytotoxic T-cells.
  • Tissue specificity

    Expressed specifically in natural killer cells, activated macrophages and cytotoxic T-cells. Present in natural killer cells (at protein level).
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the RBR family. RNF19 subfamily.
    Contains 1 IBR-type zinc finger.
    Contains 2 RING-type zinc fingers.
  • Domain

    The first IBR-type zinc finger is the most crucial for interaction with UBE2L3, UBE2L6 and UCKL1.
  • Cellular localization

    Cytoplasmic granule membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin-protein ligase RNF19B antibody
    • FLJ90005 antibody
    • IBR domain containing 3 antibody
    • IBR domain-containing protein 3 antibody
    • IBRDC3 antibody
    • Natural killer lytic-associated molecule antibody
    • NKLAM antibody
    • RING finger protein 19B antibody
    • RN19B_HUMAN antibody
    • rnf19b antibody
    see all

Images

  • Anti-RNF19B antibody (ab186483) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size: 52 kDa

References

ab186483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up