Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF216
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human RNF216 aa 288-367.
    Sequence:

    VKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIII NPSSSLLASQDETKLPKIDFFDYSKLTPLD


    Database link: Q9NWF9

  • Positive control

    • IHC-P: Human small intestine tissue. ICC/IF: U-2 OS cells.
  • General notes

    Protein previously labeled as TRIAD3.

Properties

Applications

Our Abpromise guarantee covers the use of ab224107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100

Target

  • Relevance

    The TRIAD3 gene encodes a cytoplasmic protein which specifically colocalizes and interacts with the serine/threonine protein kinase, receptor-interacting protein (RIP). Zinc finger domains of the encoded protein are required for its interaction with RIP and for inhibition of TNF- and IL1-induced NF-kappa B activation pathways. The encoded protein may also function as an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes and transfers it to substrates. Several alternatively spliced transcript variants have been described for this locus but the full-length natures of only some are known.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • CAHH antibody
    • E3 ubiquitin ligase TRIAD3 antibody
    • E3 ubiquitin-protein ligase RNF216 antibody
    • ring finger protein 216 antibody
    • RNF216 antibody
    • Triad domain-containing protein 3 antibody
    • TRIAD3 antibody
    • U7I1 antibody
    • UBCE7IP1 antibody
    • Ubiquitin conjugating enzyme 7 interacting protein 1 antibody
    • UiP83 antibody
    • ZIN antibody
    • Zinc finger protein inhibiting NF kappa B antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for RNF216 (green) using ab224107 (4 µg/ml) in ICC/IF.

  • Paraffin-embedded human small intestine tissue stained for RNF216 with ab224107 (1/50) in immunohistochemical analysis.

References

ab224107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up