Anti-RNF22 antibody (ab232988)
Key features and details
- Rabbit polyclonal to RNF22
- Suitable for: IHC-P, WB
- Reacts with: Rat, Cow, Human
- Isotype: IgG
Overview
-
Product name
Anti-RNF22 antibody
See all RNF22 primary antibodies -
Description
Rabbit polyclonal to RNF22 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Cow, Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human RNF22 aa 2-152. Two N-terminal tags. (Expressed in E.coli).
Sequence:AKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIP AQSLTLSCPVCRQTSILPEQGVSALQNNFFISSLMEAMQQAPDGAHDPED PHPLSVVAGRPLSCPNHEGKTMEFYCEACETAMCGECRAGEHREHGTVLL R
Database link: O75382 -
Positive control
- WB: Recombinant human RNF22 protein; Rat and cow cerebrum tissue lysate; Human serum. IHC-P: Human brain tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab232988 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 80 kDa. |
Target
-
Function
Probably involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation. -
Tissue specificity
Expressed in brain, heart, uterus and testis. -
Sequence similarities
Belongs to the TRIM/RBCC family.
Contains 1 B box-type zinc finger.
Contains 1 filamin repeat.
Contains 6 NHL repeats.
Contains 1 RING-type zinc finger. -
Domain
The interaction with MYO5B is dependent upon its NHL repeats, which form a beta-propeller (NHL) domain containing six blades. -
Cellular localization
Cytoplasm. Early endosome. - Information by UniProt
-
Database links
- Entrez Gene: 534510 Cow
- Entrez Gene: 10612 Human
- Entrez Gene: 55992 Mouse
- Entrez Gene: 83616 Rat
- Omim: 605493 Human
- SwissProt: O75382 Human
- SwissProt: Q9R1R2 Mouse
- SwissProt: O70277 Rat
see all -
Alternative names
- BERP antibody
- Brain expressed ring finger antibody
- Brain-expressed RING finger protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RNF22 antibody (ab232988)
Formalin-fixed, paraffin-embedded human brain tissue stained for RNF22 at 20μg/ml in immunohistochemical analysis. DAB staining.
-
Anti-RNF22 antibody (ab232988) at 2 µg/ml + Recombinant human RNF22
Developed using the ECL technique.
Predicted band size: 80 kDa -
Anti-RNF22 antibody (ab232988) at 2 µg/ml + Rat cerebrum tissue lysate
Developed using the ECL technique.
Predicted band size: 80 kDa -
Anti-RNF22 antibody (ab232988) at 2 µg/ml + Cow cerebrum tissue lysate
Developed using the ECL technique.
Predicted band size: 80 kDa -
Anti-RNF22 antibody (ab232988) at 1 µg/ml + Human serum
Developed using the ECL technique.
Predicted band size: 80 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab232988 has not yet been referenced specifically in any publications.