Anti-RNF22 antibody (ab232988)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-RNF22 antibody
See all RNF22 primary antibodies -
Description
Rabbit polyclonal to RNF22 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Cow, Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human RNF22 aa 2-152. Two N-terminal tags. (Expressed in E.coli).
Sequence:AKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIP AQSLTLSCPVCRQTSILPEQGVSALQNNFFISSLMEAMQQAPDGAHDPED PHPLSVVAGRPLSCPNHEGKTMEFYCEACETAMCGECRAGEHREHGTVLL R
Database link: O75382 -
Positive control
- WB: Recombinant human RNF22 protein; Rat and cow cerebrum tissue lysate; Human serum. IHC-P: Human brain tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab232988 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 80 kDa. |
Target
-
Function
Probably involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation. -
Tissue specificity
Expressed in brain, heart, uterus and testis. -
Sequence similarities
Belongs to the TRIM/RBCC family.
Contains 1 B box-type zinc finger.
Contains 1 filamin repeat.
Contains 6 NHL repeats.
Contains 1 RING-type zinc finger. -
Domain
The interaction with MYO5B is dependent upon its NHL repeats, which form a beta-propeller (NHL) domain containing six blades. -
Cellular localization
Cytoplasm. Early endosome. - Information by UniProt
-
Database links
- Entrez Gene: 534510 Cow
- Entrez Gene: 10612 Human
- Entrez Gene: 55992 Mouse
- Entrez Gene: 83616 Rat
- Omim: 605493 Human
- SwissProt: O75382 Human
- SwissProt: Q9R1R2 Mouse
- SwissProt: O70277 Rat
see all -
Alternative names
- BERP antibody
- Brain expressed ring finger antibody
- Brain-expressed RING finger protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RNF22 antibody (ab232988)Formalin-fixed, paraffin-embedded human brain tissue stained for RNF22 at 20μg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-RNF22 antibody (ab232988)Anti-RNF22 antibody (ab232988) at 2 µg/ml + Recombinant human RNF22
Developed using the ECL technique.
Predicted band size: 80 kDa -
Western blot - Anti-RNF22 antibody (ab232988)Anti-RNF22 antibody (ab232988) at 2 µg/ml + Rat cerebrum tissue lysate
Developed using the ECL technique.
Predicted band size: 80 kDa -
Western blot - Anti-RNF22 antibody (ab232988)Anti-RNF22 antibody (ab232988) at 2 µg/ml + Cow cerebrum tissue lysate
Developed using the ECL technique.
Predicted band size: 80 kDa -
Western blot - Anti-RNF22 antibody (ab232988)Anti-RNF22 antibody (ab232988) at 1 µg/ml + Human serum
Developed using the ECL technique.
Predicted band size: 80 kDa
Datasheets and documents
References
ab232988 has not yet been referenced specifically in any publications.
