Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF43
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human RNF43 aa 30-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LVLAAAVESERSAEQKAIIRVIPLKMDPTGKLNLTLEGVFAGVAEITPAE G


    Database link: Q68DV7

  • Positive control

    • Human lung carcinoma and mouse testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab217787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Relevance

    Function: E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination, endocytosis and subsequent degradation of Wnt receptor complex components Frizzled. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Tissue specificity: Expressed in fetal kidney, fetal lung, in colon cancer tissues, hepatocellular carcinomas and lung adenocarcinomas. Overexpressed in colorectal cancer cell lines. Pathway: Protein modification; protein ubiquitination. Similarity: Belongs to the ZNRF3 family. Contains 1 RING-type zinc finger. PTM: Autoubiquitinated.
  • Cellular localization

    Endoplasmic reticulum membrane; Single-pass type I membrane protein. Nucleus envelope. Note: may be secreted.
  • Database links

  • Alternative names

    • 4732452J19Rik antibody
    • DKFZp781H02126 antibody
    • DKFZp781H0392 antibody
    • E3 ubiquitin-protein ligase RNF43 antibody
    • FLJ20315 antibody
    • FLJ77466 antibody
    • FLJ99338 antibody
    • MGC125630 antibody
    • RGD1305204 antibody
    • RING finger protein 43 antibody
    • RNF124 antibody
    • Rnf43 antibody
    • RNF43_HUMAN antibody
    • RP23-449P23.1 antibody
    • SSPCS antibody
    • URCC antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung carcinoma tissue labeling RNF43 with ab217787 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse testis tissue labeling RNF43 with ab217787 at 1/100 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (skin)
Permeabilization
Yes - citrate
Specification
skin
Blocking step
Serum as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted May 30 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up