Overview

  • Product name

  • Description

    Rabbit polyclonal to RNF5/NG2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RNF5/NG2 aa 1-120.
    Sequence:

    MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPC LHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQG QRPAPESRGGFQPFGDTGGF


    Database link: Q99942

  • Positive control

    • IHC-P: Human liver cancer and gastric cancer tissue. ICC/IF: HEK-293 cells.
  • General notes

     This product was previously labelled as RNF5

     

Properties

Applications

Our Abpromise guarantee covers the use of ab237769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Has E2-dependent E3 ubiquitin-protein ligase activity. May function together with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. Mediates ubiquitination of PXN/paxillin and Salmonella type III secreted protein sopA. May be involved in regulation of cell motility and localization of PXN/paxillin. Mediates the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD; the ubiquitination appears to involve E2 ubiquitin-conjugating enzyme UBE2N. Mediates the 'Lys-48'-linked polyubiquitination of TMEM173 at 'Lys-150' leading to its proteasomal degradation; the ubiquitination occurrs in mitochondria after viral transfection and regulates antiviral responses.
  • Tissue specificity

    Widely expressed.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
  • Cellular localization

    Membrane. Mitochondrion membrane. Endoplasmic reticulum membrane. Predominantly located in the plasma membrane, with some localization occurring within cytoplasmic organelles.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin protein ligase RNF5 antibody
    • E3 ubiquitin-protein ligase RNF5 antibody
    • G16 antibody
    • HsRma1 antibody
    • NG2 antibody
    • OTTHUMP00000029107 antibody
    • Protein G16 antibody
    • Ram1 homolog antibody
    • RING finger protein 5 antibody
    • RING5 antibody
    • RMA1 antibody
    • RNF 5 antibody
    • RNF5 antibody
    • RNF5_HUMAN antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for RNF5/NG2 using ab237769 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for RNF5/NG2 using ab237769 at 1/100 dilution in immunohistochemical analysis.

  • HEK-293 (human epithelial cell line from embryonic kidney) cells stained for RNF5/NG2 (green) using ab237769 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab237769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up