Anti-Robo2 antibody (ab244331)
Key features and details
- Rabbit polyclonal to Robo2
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Robo2 antibody
See all Robo2 primary antibodies -
Description
Rabbit polyclonal to Robo2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human Robo2 aa 934-1070.
Sequence:PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKT SYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGF GYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA
Database link: Q9HCK4 -
Positive control
- WB: HEL whole cell lysates; IHC-P: Mouse embryo E14, human cerebral cortex and placenta tissue; ICC: SH-SY5Y cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244331 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 151 kDa. |
Target
-
Function
Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. -
Involvement in disease
Defects in ROBO2 are the cause of vesicoureteral reflux type 2 (VUR2) [MIM:610878]. VUR is a complex, genetically heterogeneous developmental disorder characterized by the retrograde flow of urine from the bladder into the ureter and is associated with reflux nephropathy, the cause of 15% of end-stage renal disease in children and young adults.
Note=A chromosomal aberration involving ROBO2 is a cause of multiple congenital abnormalities, including severe bilateral VUR with ureterovesical junction defects. Translocation t(Y;3)(p11;p12) with PCDH11Y. This translocation disrupts ROBO2 and produces dominant-negative ROBO2 proteins that abrogate SLIT-ROBO signaling in vitro. -
Sequence similarities
Belongs to the immunoglobulin superfamily. ROBO family.
Contains 3 fibronectin type-III domains.
Contains 5 Ig-like C2-type (immunoglobulin-like) domains. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 6092 Human
- Entrez Gene: 268902 Mouse
- Omim: 602431 Human
- SwissProt: Q9HCK4 Human
- SwissProt: Q7TPD3 Mouse
- Unigene: 13305 Human
- Unigene: 171736 Mouse
-
Alternative names
- lea antibody
- Robo 2 antibody
- Robo2 antibody
see all
Images
-
Anti-Robo2 antibody (ab244331) at 0.4 µg/ml + HEL (human bone marrow erythroleukemia cell line) whole cell lysate
Predicted band size: 151 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
Immunohistochemical analysis of mouse embryo E14 tissue labeling Robo2 in developing olfatory bulb and olfactory nerve with ab244331 at 1/20 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunofluorescent analysis of SH-SY5Y (Human neuroblastoma cell line from bone marrow) cells labeling Robo2 (green) in the nucleus with ab244331 at 2 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
Immunohistochemical analysis of human cerebral cortex tissue labeling Robo2 in neuronal processes in neuropil with ab244331 at 1/20 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
Immunohistochemical analysis of human placenta tissue labeling Robo2 in the cytoplasm of trophoblastic cels with ab244331 at 1/20 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
Immunohistochemical analysis of human liver tissue labeling Robo2 (very weak positivity) with ab244331 at 1/20 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
Immunohistochemical analysis of human kidney tissue labeling Robo2 with ab244331 at 1/20 dilution. Negative control.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244331 has not yet been referenced specifically in any publications.