Anti-Robo2 antibody (ab244331)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Robo2 antibody
See all Robo2 primary antibodies -
Description
Rabbit polyclonal to Robo2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human Robo2 aa 934-1070.
Sequence:PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKT SYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGF GYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA
Database link: Q9HCK4 -
Positive control
- IHC-P: Human cerebral cortex tissue. ICC/IF: SH-SY5Y cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244331 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. -
Involvement in disease
Defects in ROBO2 are the cause of vesicoureteral reflux type 2 (VUR2) [MIM:610878]. VUR is a complex, genetically heterogeneous developmental disorder characterized by the retrograde flow of urine from the bladder into the ureter and is associated with reflux nephropathy, the cause of 15% of end-stage renal disease in children and young adults.
Note=A chromosomal aberration involving ROBO2 is a cause of multiple congenital abnormalities, including severe bilateral VUR with ureterovesical junction defects. Translocation t(Y;3)(p11;p12) with PCDH11Y. This translocation disrupts ROBO2 and produces dominant-negative ROBO2 proteins that abrogate SLIT-ROBO signaling in vitro. -
Sequence similarities
Belongs to the immunoglobulin superfamily. ROBO family.
Contains 3 fibronectin type-III domains.
Contains 5 Ig-like C2-type (immunoglobulin-like) domains. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 6092 Human
- Entrez Gene: 268902 Mouse
- Omim: 602431 Human
- SwissProt: Q9HCK4 Human
- SwissProt: Q7TPD3 Mouse
- Unigene: 13305 Human
- Unigene: 171736 Mouse
-
Alternative names
- lea antibody
- Robo 2 antibody
- Robo2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)Formalin-fixed, paraffin-embedded human cerebral cortex tissue stained for Robo2 with ab244331 at a 1/20 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-Robo2 antibody (ab244331)PFA fixed, Triton X-100 permeabilized SH-SY5Y (Human neuroblastoma cell line from bone marrow) cells labeling Robo2 using ab244331 at 4 µg/ml (green) in ICC/IF.
Datasheets and documents
References
ab244331 has not yet been referenced specifically in any publications.
