For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    robo2-antibody-ab244331.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurology process Growth and Development Axonal Guidance Proteins
Share by email

Anti-Robo2 antibody (ab244331)

  • Datasheet
Reviews (1) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Robo2 antibody (ab244331)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
  • Immunocytochemistry/ Immunofluorescence - Anti-Robo2 antibody (ab244331)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)

Key features and details

  • Rabbit polyclonal to Robo2
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-Robo2 antibody
    See all Robo2 primary antibodies
  • Description

    Rabbit polyclonal to Robo2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Robo2 aa 934-1070.
    Sequence:

    PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKT SYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGF GYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA


    Database link: Q9HCK4
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEL whole cell lysates; IHC-P: Mouse embryo E14, human cerebral cortex and placenta tissue; ICC: SH-SY5Y cells.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurology process
    • Growth and Development
    • Axonal Guidance Proteins
    • Neuroscience
    • Neurology process
    • Neurogenesis
    • Neuroscience
    • Cell Type Marker
    • Neuron marker
    • Axon marker
    • Neuroscience
    • Neurology process
    • Neuroregeneration
    • Neuroregeneration

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

Applications

Our Abpromise guarantee covers the use of ab244331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 151 kDa.

Target

  • Function

    Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development.
  • Involvement in disease

    Defects in ROBO2 are the cause of vesicoureteral reflux type 2 (VUR2) [MIM:610878]. VUR is a complex, genetically heterogeneous developmental disorder characterized by the retrograde flow of urine from the bladder into the ureter and is associated with reflux nephropathy, the cause of 15% of end-stage renal disease in children and young adults.
    Note=A chromosomal aberration involving ROBO2 is a cause of multiple congenital abnormalities, including severe bilateral VUR with ureterovesical junction defects. Translocation t(Y;3)(p11;p12) with PCDH11Y. This translocation disrupts ROBO2 and produces dominant-negative ROBO2 proteins that abrogate SLIT-ROBO signaling in vitro.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. ROBO family.
    Contains 3 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession Q9HCK4 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 6092 Human
    • Entrez Gene: 268902 Mouse
    • Omim: 602431 Human
    • SwissProt: Q9HCK4 Human
    • SwissProt: Q7TPD3 Mouse
    • Unigene: 13305 Human
    • Unigene: 171736 Mouse
    • Alternative names

      • lea antibody
      • Robo 2 antibody
      • Robo2 antibody
      • ROBO2_HUMAN antibody
      • Roundabout 2 antibody
      • Roundabout homolog 2 antibody
      • roundabout, axon guidance receptor, homolog 2 (Drosophila) antibody
      • Roundabout2 antibody
      • SAX 3 antibody
      • SAX3 antibody
      see all

    Images

    • Western blot - Anti-Robo2 antibody (ab244331)
      Western blot - Anti-Robo2 antibody (ab244331)
      Anti-Robo2 antibody (ab244331) at 0.4 µg/ml + HEL (human bone marrow erythroleukemia cell line) whole cell lysate

      Predicted band size: 151 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)

      Immunohistochemical analysis of mouse embryo E14 tissue labeling Robo2 in developing olfatory bulb and olfactory nerve with ab244331 at 1/20 dilution.

      Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    • Immunocytochemistry/ Immunofluorescence - Anti-Robo2 antibody (ab244331)
      Immunocytochemistry/ Immunofluorescence - Anti-Robo2 antibody (ab244331)

      Immunofluorescent analysis of SH-SY5Y (Human neuroblastoma cell line from bone marrow) cells labeling Robo2 (green) in the nucleus with ab244331 at 2 µg/ml.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)

      Immunohistochemical analysis of human cerebral cortex tissue labeling Robo2 in neuronal processes in neuropil with ab244331 at 1/20 dilution.

      Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)

      Immunohistochemical analysis of human placenta tissue labeling Robo2 in the cytoplasm of trophoblastic cels with ab244331 at 1/20 dilution.

      Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)

      Immunohistochemical analysis of human liver tissue labeling Robo2 (very weak positivity) with ab244331 at 1/20 dilution. 

      Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Robo2 antibody (ab244331)

      Immunohistochemical analysis of human kidney tissue labeling Robo2 with ab244331 at 1/20 dilution. Negative control.

      Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab244331? Please let us know so that we can cite the reference in this datasheet.

    ab244331 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Immunohistochemistry (Frozen sections) abreview for Anti-Robo2 antibody

    Average
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Frozen sections)
    Sample
    Mouse Tissue sections (Brain)
    Permeabilization
    Yes - 0,3% Trition
    Specification
    Brain
    Blocking step
    Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: RT°C
    Fixative
    Paraformaldehyde
    Read More

    Abcam user community

    Verified customer

    Submitted Nov 25 2019

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.