Overview

  • Product name

  • Description

    Rabbit polyclonal to Robo3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Robo3 aa 1237-1386.
    Sequence:

    EMTPPLQGPRARFRKKPKALPYRRENSPGDLPPPPLPPPEEEASWALELR AAGSMSSLERERSGERKAVQAVPLAAQRVLHPDEEAWLPYSRPSFLSRGQ GTSTCSTAGSNSSRGSSSSRGSRGPGRSRSRSQSRSQSQRPGQKRREEPR


    Database link: Q96MS0

  • Positive control

    • IHC-P: Human gastric cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab229722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Thought to be involved during neural development in axonal navigation at the ventral midline of the neural tube. In spinal chord development plays a role in guiding commissural axons probably by preventing premature sensitivity to Slit proteins thus inhibiting Slit signaling through ROBO1 (By similarity). Required for hindbrain axon midline crossing.
  • Involvement in disease

    Defects in ROBO3 are a cause of familial horizontal gaze palsy with progressive scoliosis (HGPPS) [MIM:607313]. Patients show a medulla where motor and sensory projections appear uncrossed.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. ROBO family.
    Contains 3 fibronectin type-III domains.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ21044 antibody
    • HGPPS antibody
    • HGPS antibody
    • RB inhibiting gene 1 antibody
    • Rbig 1 antibody
    • Rbig1 antibody
    • Retinoblastoma inhibiting gene 1 antibody
    • Rig 1 antibody
    • Rig1 antibody
    • Robo 3 antibody
    • Robo3 antibody
    • Robo3 protein antibody
    • ROBO3_HUMAN antibody
    • Roundabout axon guidance receptor homolog 3 antibody
    • Roundabout homolog 3 antibody
    • Roundabout like protein 3 antibody
    • Roundabout, axon guidance receptor, homolog 3 (Drosophila) antibody
    • Roundabout-like protein 3 antibody
    see all

Images

  • Paraffin-embedded human gastric cancer tissue stained for Robo3 using ab229722 at 1/100 dilution in immunohistochemical analysis.

References

ab229722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up