Overview

  • Product name

    Anti-ROC2 antibody
  • Description

    Rabbit polyclonal to ROC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human ROC2 aa 2-113.
    Sequence:

    ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCA ICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPL CQQDWVVQRIGK


    Database link: Q9UBF6

  • Positive control

    • IHC-P: Human kidney and spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.

Target

  • Relevance

    ROC2 appears to recruit the E2 ubiquitination enzyme through the RING-type zinc finger in a manner similar to CDC34, and brings it into close proximity to the substrate. ROC2 may play a role in protecting cells from apoptosis induced by redox agents. ROC2 has a cytoplasmic and nuclear localization and is expressed in heart, liver, skeletal muscle and pancreas tissues, and at very low levels in brain, placenta and lung. 1,10-phenanthroline induces ROC2 expression. The RING-type zinc finger domain is essential for ubiquitin ligase activity. Phosphorylation by CK2 is required for efficient degradation of NFKBIA and CDKN1B.
  • Cellular localization

    Cytoplasmic and Nuclear
  • Database links

  • Alternative names

    • CKBBP1 antibody
    • CKII beta-binding protein 1 antibody
    • Rbx2 antibody
    • Regulator of cullins 2 antibody
    • ring finger protein 7 antibody
    • RING-box protein 2 antibody
    • RNF7 antibody
    • SAG antibody
    • Sensitive to apoptosis gene protein antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for ROC2 using ab238564 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human spleen tissue stained for ROC2 using ab238564 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab238564 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up