Name: Anti-ROMO1 antibody [OTI2C12]
SKU: ab236409

Product name

Anti-ROMO1 antibody [OTI2C12]
See all ROMO1 primary antibodies
Description

Mouse monoclonal [OTI2C12] to ROMO1
Host species

Mouse
Tested applications

Suitable for: WB, ICC/IF, IHC-Pmore details
Species reactivity

Reacts with: Dog, Human
Predicted to work with: Mouse, Cow, Pig
Immunogen

Recombinant full length protein corresponding to Human ROMO1 aa 1-79. (NP_542786) produced in HEK-293T cells.
Sequence:
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGR ELMGGIGKTMMQSGGTFGTFMAIGMGIRC

Database link: P60602

Run BLAST with Run BLAST with
Positive control
- WB: HepG2, HeLa, SVT2, A549, COS-7, Jurkat and MDCK whole cell lysates; pCMV6-ENTRY ROMO1 transfected HEK-293T whole cell lysate. IHC-P: Human breast, breast adenocarcinoma, colon adenocarcinoma, ovary adenocarcinoma, endometrial adenocarcinoma, normal pancreas, thyroid carcinoma, normal prostate and normal kidney tissue. ICC/IF: COS-7 and HeLa cells.
General notes

Clone OTI2C12 (formerly 2C12)

Form

Liquid
Storage instructions

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Storage buffer

pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol
Concentration information loading...
Purity

Affinity purified
Purification notes

Purified from cell culture supernatant.
Clonality

Monoclonal
Clone number

OTI2C12
Isotype

IgG1
Research areas

Compatible Secondaries
- Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
- Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Isotype control
- Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
Positive Controls

Our Abpromise guarantee covers the use of ab236409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application	Abreviews	Notes
WB		1/2000. Predicted molecular weight: 8 kDa.
ICC/IF		1/100.
IHC-P		1/150. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes

Function

Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence.
Tissue specificity

Up-regulated in a number of cancer cell lines when compared to a normal lung fibroblast cell line.
Sequence similarities

Belongs to the MGR2 family.
Developmental stage

Expression increases in senescent cells.
Cellular localization

Mitochondrion membrane.
Target information above from: UniProt accession P60602 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
Database links
- Entrez Gene: 140823 Human
- Entrez Gene: 67067 Mouse
- SwissProt: Q3SZV8 Cow
- SwissProt: P60602 Human
- SwissProt: P60603 Mouse
- SwissProt: A1XQR6 Pig
- Unigene: 472564 Human
- Unigene: 371623 Mouse
Alternative names
- bA353C18.2 antibody
- C20orf52 antibody
- Mitochondrial targeting GXXXG protein antibody
- MTGMP antibody
- Protein MGR2 homolog antibody
- Reactive oxygen species modulator 1 antibody
- ROMO1 antibody
- ROMO1_HUMAN antibody
- ROS modulator 1 antibody
see all

Western blot - Anti-ROMO1 antibody [OTI2C12] (ab236409)

All lanes : Anti-ROMO1 antibody [OTI2C12] (ab236409) at 1/2000 dilution

Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control, whole cell lysate
Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY ROMO1, whole cell lysate

Lysates/proteins at 5 µg per lane.

Predicted band size: 8 kDa
Western blot - Anti-ROMO1 antibody [OTI2C12] (ab236409)

All lanes : Anti-ROMO1 antibody [OTI2C12] (ab236409) at 1/2000 dilution

Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Lane 3 : SVT2 whole cell lysate
Lane 4 : A549 (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) whole cell lysate
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
Lane 7 : MDCK (canine kidney cell line) whole cell lysate

Lysates/proteins at 10 µg per lane.

Predicted band size: 8 kDa
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ROMO1 antibody [OTI2C12] (ab236409)

Paraffin-embedded human breast tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ROMO1 antibody [OTI2C12] (ab236409)

Paraffin-embedded human breast adenocarcinoma tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ROMO1 antibody [OTI2C12] (ab236409)

Paraffin-embedded human colon adenocarcinoma tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ROMO1 antibody [OTI2C12] (ab236409)

Paraffin-embedded human kidney tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ROMO1 antibody [OTI2C12] (ab236409)

Paraffin-embedded human ovary adenocarcinoma tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ROMO1 antibody [OTI2C12] (ab236409)

Paraffin-embedded human pancreas tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ROMO1 antibody [OTI2C12] (ab236409)

Paraffin-embedded human thyroid tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ROMO1 antibody [OTI2C12] (ab236409)

Paraffin-embedded human endometrial adenocarcinoma tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ROMO1 antibody [OTI2C12] (ab236409)

Paraffin-embedded human prostate tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.
Immunocytochemistry/ Immunofluorescence - Anti-ROMO1 antibody [OTI2C12] (ab236409)

COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY ROMO1 stained for ROMO1 (green) using ab236409 at 1/100 dilution in ICC/IF.
Immunocytochemistry/ Immunofluorescence - Anti-ROMO1 antibody [OTI2C12] (ab236409)

HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for ROMO1 (green) using ab236409 at 1/100 dilution in ICC/IF.

Datasheet

ab236409 has not yet been referenced specifically in any publications.

Publishing research using ab236409? Please let us know so that we can cite the reference in this datasheet.

Location selector

Your location is currently set to:

Custom solutions & partnerships

Anti-ROMO1 antibody [OTI2C12] (ab236409)

Overview

Properties

Associated products

Applications

Target

Images

Datasheets and documents

References

Customer reviews and Q&As