Overview

  • Product name
    Anti-ROMO1 antibody [OTI2C12]
    See all ROMO1 primary antibodies
  • Description
    Mouse monoclonal [OTI2C12] to ROMO1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Dog, Human
    Predicted to work with: Mouse, Cow, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human ROMO1 aa 1-79. (NP_542786) produced in HEK-293T cells.
    Sequence:

    MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGR ELMGGIGKTMMQSGGTFGTFMAIGMGIRC


    Database link: P60602

  • Positive control
    • WB: HepG2, HeLa, SVT2, A549, COS-7, Jurkat and MDCK whole cell lysates; pCMV6-ENTRY ROMO1 transfected HEK-293T whole cell lysate. IHC-P: Human breast, breast adenocarcinoma, colon adenocarcinoma, ovary adenocarcinoma, endometrial adenocarcinoma, normal pancreas, thyroid carcinoma, normal prostate and normal kidney tissue. ICC/IF: COS-7 and HeLa cells.
  • General notes

    Clone OTI2C12 (formerly 2C12)

Properties

Applications

Our Abpromise guarantee covers the use of ab236409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 8 kDa.
ICC/IF 1/100.
IHC-P 1/150.

Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes

Target

  • Function
    Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence.
  • Tissue specificity
    Up-regulated in a number of cancer cell lines when compared to a normal lung fibroblast cell line.
  • Sequence similarities
    Belongs to the MGR2 family.
  • Developmental stage
    Expression increases in senescent cells.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • bA353C18.2 antibody
    • C20orf52 antibody
    • Mitochondrial targeting GXXXG protein antibody
    • MTGMP antibody
    • Protein MGR2 homolog antibody
    • Reactive oxygen species modulator 1 antibody
    • ROMO1 antibody
    • ROMO1_HUMAN antibody
    • ROS modulator 1 antibody
    see all

Images

  • All lanes : Anti-ROMO1 antibody [OTI2C12] (ab236409) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control, whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY ROMO1, whole cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 8 kDa

  • All lanes : Anti-ROMO1 antibody [OTI2C12] (ab236409) at 1/2000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : SVT2 whole cell lysate
    Lane 4 : A549 (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) whole cell lysate
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 7 : MDCK (canine kidney cell line) whole cell lysate

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 8 kDa

  • Paraffin-embedded human breast tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast adenocarcinoma tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon adenocarcinoma tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrial adenocarcinoma tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for ROMO1 using ab236409 at 1/150 dilution in immunohistochemical analysis.

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY ROMO1 stained for ROMO1 (green) using ab236409 at 1/100 dilution in ICC/IF. 

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for ROMO1 (green) using ab236409 at 1/100 dilution in ICC/IF.

References

ab236409 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up