Overview

  • Product name

    Anti-RON (phospho Y1238) antibody
    See all RON primary antibodies
  • Description

    Rabbit polyclonal to RON (phospho Y1238)
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human RON aa 1220-1260 (phospho Y1238) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    FTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ


    Database link: Q04912

  • Positive control

    • Rat brain tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab203752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 152 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

Target

  • Function

    Receptor for macrophage stimulating protein (MSP). Has a tyrosine-protein kinase activity.
  • Tissue specificity

    Keratinocytes and lung.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family.
    Contains 3 IPT/TIG domains.
    Contains 1 protein kinase domain.
    Contains 1 Sema domain.
  • Post-translational
    modifications

    Proteolytic processing yields the two subunits.
    Phosphorylated in response to ligand binding.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • c met related tyrosine kinase antibody
    • CD136 antibody
    • CD136 antigen antibody
    • CDw136 antibody
    • Macrophage stimulating 1 receptor (c met related tyrosine kinase) antibody
    • Macrophage stimulating 1 receptor antibody
    • Macrophage stimulating protein receptor alpha chain antibody
    • MACROPHAGE STIMULATING PROTEIN RECEPTOR antibody
    • Macrophage stimulating protein receptor beta chain antibody
    • Macrophage-Stimulating 1 Receptor (MST1R) antibody
    • Macrophage-stimulating protein receptor beta chain antibody
    • MSP receptor antibody
    • Mst1r antibody
    • MST1R variant RON30 antibody
    • MST1R variant RON62 antibody
    • NPCA3 antibody
    • p185 RON antibody
    • p185-Ron antibody
    • Protein-tyrosine kinase 8 antibody
    • PTK 8 antibody
    • ptk8 antibody
    • PTK8 protein tyrosine kinase 8 antibody
    • Recepteur d’origine nantais (RON) antibody
    • RON antibody
    • RON protein tyrosine kinase antibody
    • RON variant E2E3 antibody
    • RON_HUMAN antibody
    • Soluble RON variant 1 antibody
    • Soluble RON variant 2 antibody
    • Soluble RON variant 3 antibody
    • Soluble RON variant 4 antibody
    • Stem cell derived tyrosine kinase antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded rat brain tissue labeling RON (phospho Y1238) using ab203752 at 1/200 dilution, followed by secondary detection and DAB staining.

References

ab203752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up