Overview

  • Product name

  • Description

    Rabbit polyclonal to ROPN1B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ROPN1B aa 1-120.
    Sequence:

    MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETP PVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLP TDLFNSVMNVGRFTEEIEWL


    Database link: Q9BZX4

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab239021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Belongs to the ropporin family.
    Contains 1 RIIa domain.
  • Domain

    The RIIa domain mediates interaction with AKAP3.
  • Cellular localization

    In the sperm tail, found in the principal piece and in the cytoplasmic droplet located at the distal end of the midpiece. Inner surface of the fibrous sheath.
  • Information by UniProt
  • Database links

  • Alternative names

    • AKAP binding sperm protein ropporin antibody
    • Rhophilin associated protein 1B antibody
    • Rhophilin-associated protein 1B antibody
    • ROP1B_HUMAN antibody
    • ROPN 1B antibody
    • ROPN1B antibody
    • Ropporin 1B antibody
    • Ropporin rhophilin associated protein 1B antibody
    • Ropporin-1B antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for ROPN1B with ab239021 at 1/100 dilution in immunohistochemical analysis.

References

ab239021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up