Overview

  • Product name

    Anti-ROR alpha/RORA antibody
    See all ROR alpha/RORA primary antibodies
  • Description

    Rabbit polyclonal to ROR alpha/RORA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, ChIP, WB, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human ROR alpha/RORA aa 206-255 (internal sequence).
    Sequence:

    GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP


    (Peptide available as ab151609)

  • Positive control

    • Jurkat cells. Kidney tissue.
  • General notes

     This product was previously labelled as ROR alpha

     

Properties

Applications

Our Abpromise guarantee covers the use of ab60134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 µg/ml.
ChIP Use at an assay dependent concentration. PubMed: 23922987
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 68 kDa (predicted molecular weight: 63 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

Target

  • Function

    Orphan nuclear receptor. Binds DNA as a monomer to hormone response elements (HRE) containing a single core motif half-site preceded by a short A-T-rich sequence. This isomer binds to the consensus sequence 5'-[AT][TA]A[AT][CGT]TAGGTCA-3'. Regulates a number of genes involved in lipid metabolism such as apolipoproteins AI, APOA5, CIII, CYP71 and PPARgamma, in cerebellum and photoreceptor development including PCP2, OPN1SW, OPN1SM AND ARR3, in circadian rhythm with BMAL1, and skeletal muscle development with MYOD1. Possible receptor for cholesterol or one of its derivatives.
  • Tissue specificity

    Widely expressed in a number of tissues.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Post-translational
    modifications

    Phosphorylation by PKC in neurons inhibits transcriptional activity. Phosphorylated on Thr-216 by ERK2 in vitro.
    Sumoylated by SENP1 and SENP2. Sumoylation, promoted by PIAS2, PIAS3, PIASy but not PIAS1, enhances the transcriptional activity. Desumoylated by SENP1.
    Ubiquitinated. Ubiquitination is required for efficient transcriptional activity and is prevented by Hairless.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • fhl2a antibody
    • NR1F1 antibody
    • Nuclear receptor ROR alpha antibody
    • Nuclear receptor ROR-alpha antibody
    • Nuclear receptor RZR-alpha antibody
    • Nuclear receptor subfamily 1 group F member 1 antibody
    • RAR related orphan receptor A antibody
    • RAR related orphan receptor alpha antibody
    • RAR-related orphan receptor A antibody
    • Retinoid-related orphan receptor-alpha antibody
    • Rora antibody
    • RORA_HUMAN antibody
    • RZR alpha antibody
    • RZR-ALPHA antibody
    • RZRA antibody
    • Transcription factor RZR alpha antibody
    see all

Images

  • All lanes : Anti-ROR alpha/RORA antibody (ab60134) at 1.25 µg/ml

    Lane 1 : Molecular weight marker
    Lane 2 : Jurkat cell lysate

    Secondary
    All lanes : HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 63 kDa
    Observed band size: 68 kDa
    why is the actual band size different from the predicted?



    Gel concentration: 12%
  • ICC/IF image of ab60134 stained HepG2 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab60134, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling ROR alpha/RORA with ab60134 at a concentration of 4-8µg/ml. Arrows indicate positively stained epithelial cells of the renal tubule.

References

This product has been referenced in:

  • Molinaro A  et al. Liver-specific RORa deletion does not affect the metabolic susceptibility to western style diet feeding. Mol Metab 23:82-87 (2019). Read more (PubMed: 30904385) »
  • Yang Y  et al. White light emitting diode induces autophagy in hippocampal neuron cells through GSK-3-mediated GR and RORa pathways. Aging (Albany NY) 11:1832-1849 (2019). Read more (PubMed: 30923260) »
See all 17 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-4 of 4 Abreviews

Application
Western blot
Sample
Human Tissue lysate - whole (Human lung)
Gel Running Conditions
Reduced Denaturing (7.5%)
Loading amount
25 µg
Specification
Human lung
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Mar 20 2015

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Lung tissue)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate buffer pH 6.0
Permeabilization
Yes - Tween 20 0.05%
Specification
Lung tissue
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Mar 17 2015

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Lung tissue)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citrate buffer pH 6.0
Permeabilization
Yes - 0.05% tween 20
Specification
Lung tissue
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Mar 14 2015

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (mouse adult retina)
Permeabilization
Yes - 0.1% triton-x100
Specification
mouse adult retina
Blocking step
10% FBS, 1%BSA as blocking agent for 5 hour(s) and 0 minute(s) · Concentration: NA% · Temperature: 22°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Feb 20 2009

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up