Overview

  • Product name

    Anti-ROR beta/RORB antibody
    See all ROR beta/RORB primary antibodies
  • Description

    Rabbit polyclonal to ROR beta/RORB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human ROR beta/RORB aa 390-440 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQ V


    Database link: Q92753

  • Positive control

    • Rat brain tissue.
  • General notes

     This product was previously labelled as ROR beta

     

Properties

Applications

Our Abpromise guarantee covers the use of ab217752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Orphan nuclear receptor required for normal postnatal development of rod and cone photoreceptor cells. Regulates transcription of OPN1SW in cone photoreceptor cells by binding the sequence 5'-AGGTCA-3' in the OPN1SW promoter.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA133M9.1 antibody
    • NR1F2 antibody
    • Nuclear receptor ROR-beta antibody
    • Nuclear receptor RZR beta antibody
    • Nuclear receptor RZR-beta antibody
    • Nuclear receptor subfamily 1 group F member 2 antibody
    • OTTHUMP00000021486 antibody
    • RAR related orphan receptor B antibody
    • RAR related orphan receptor beta antibody
    • Retinoic acid binding receptor beta antibody
    • Retinoid-related orphan receptor-beta antibody
    • ROR BETA antibody
    • Rorb antibody
    • RORB_HUMAN antibody
    • RZR BETA antibody
    • RZRB antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue, labeling ROR beta/RORB with ab217752 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up