Anti-RP9 antibody (ab246980)
Key features and details
- Rabbit polyclonal to RP9
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RP9 antibody -
Description
Rabbit polyclonal to RP9 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human RP9 aa 22-94.
Sequence:PEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCI PDVPGNEHAREFLAHAPTKGLWM
Database link: Q8TA86 -
Positive control
- IHC-P: Human hippocampus tissue. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab246980 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Is thought to be a target protein for the PIM1 kinase. May play some roles in B-cell proliferation in association with PIM1. -
Tissue specificity
Appears to be expressed in a wide range of tissues. -
Involvement in disease
Defects in RP9 are the cause of retinitis pigmentosa type 9 (RP9) [MIM:180104]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP9 inheritance is autosomal dominant. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 6100 Human
- Entrez Gene: 55934 Mouse
- Omim: 607331 Human
- SwissProt: Q8TA86 Human
- SwissProt: P97762 Mouse
- Unigene: 326805 Human
-
Alternative names
- PAP-1 antibody
- Pim-1-associated protein antibody
- PIM1-associated protein, mouse, homolog of antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized U-2 OS cells stained for RP9 (green) using ab246980 at 4 μg/ml in ICC/IF.
-
Paraffin-embedded human hippocampus tissue stained for RP9 using ab246980 at 1/500 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab246980 has not yet been referenced specifically in any publications.