Anti-RP9 antibody (ab246980)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-RP9 antibody -
Description
Rabbit polyclonal to RP9 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human RP9 aa 22-94.
Sequence:PEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCI PDVPGNEHAREFLAHAPTKGLWM
Database link: Q8TA86 -
Positive control
- IHC-P: Human hippocampus tissue. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab246980 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Is thought to be a target protein for the PIM1 kinase. May play some roles in B-cell proliferation in association with PIM1. -
Tissue specificity
Appears to be expressed in a wide range of tissues. -
Involvement in disease
Defects in RP9 are the cause of retinitis pigmentosa type 9 (RP9) [MIM:180104]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP9 inheritance is autosomal dominant. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 6100 Human
- Entrez Gene: 55934 Mouse
- Omim: 607331 Human
- SwissProt: Q8TA86 Human
- SwissProt: P97762 Mouse
- Unigene: 326805 Human
-
Alternative names
- PAP-1 antibody
- Pim-1-associated protein antibody
- PIM1-associated protein, mouse, homolog of antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-RP9 antibody (ab246980)PFA-fixed, Triton X-100 permeabilized U-2 OS cells stained for RP9 (green) using ab246980 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RP9 antibody (ab246980)Paraffin-embedded human hippocampus tissue stained for RP9 using ab246980 at 1/500 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab246980 has not yet been referenced specifically in any publications.
