Overview

  • Product name
  • Description
    Mouse polyclonal to RPA14/RPA3
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human RPA14/RPA3 aa 1-121.
    Sequence:

    MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKN GTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYN EAVKIIHDFPQFYPLGIVQHD

  • Positive control
    • RPA14/RPA3 transfected 293T cell lysate; HeLa cells.
  • General notes

     This product was previously labelled as RPA14

     

Properties

Applications

Our Abpromise guarantee covers the use of ab167593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Required for DNA recombination, repair and replication. The activity of RP-A is mediated by single-stranded DNA binding and protein interactions.
    Functions as component of the alternative replication protein A complex (aRPA). aRPA binds single-stranded DNA and probably plays a role in DNA repair; it does not support chromosomal DNA replication and cell cycle progression through S-phase. In vitro, aRPA cannot promote efficient priming by DNA polymerase alpha but supports DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • p14 antibody
    • REPA 3 antibody
    • REPA3 antibody
    • Replication factor A protein 3 antibody
    • Replication protein A 14 kDa subunit antibody
    • Replication protein A3 14kD antibody
    • Replication protein A3 14kDa antibody
    • Replication protein A3 antibody
    • RF A antibody
    • RF A protein 3 antibody
    • RF-A protein 3 antibody
    • RFA protein 3 antibody
    • RFA3_HUMAN antibody
    • RP A antibody
    • RP A p14 antibody
    • RP-A p14 antibody
    • RPA 14 antibody
    • RPA 3 antibody
    • RPA p14 antibody
    • rpa3 antibody
    see all

Images

  • All lanes : Anti-RPA14/RPA3 antibody (ab167593) at 1 µg/ml

    Lane 1 : RPA14/RPA3 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size: 14 kDa

  • Immunofluorescence analysis of HeLa cells labeling RPA14/RPA3 with ab167593 at 10 ug/ml.

References

ab167593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up