Overview

  • Product name

    Anti-RPIA/PRI antibody (FITC)
    See all RPIA/PRI primary antibodies
  • Description

    Rabbit polyclonal to RPIA/PRI (FITC)
  • Host species

    Rabbit
  • Conjugation

    FITC. Ex: 493nm, Em: 528nm
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli RPIA/PRI aa 1-219.
    Sequence:

    MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAV SSSDASTEKLKSLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAAL TREKIIASVAEKFICIADASKQVDILGKFPLPVEVIPMARSAVARQLVKL GGRPEYRQGVVTDNGNVILDVHGMEILDPIAMENAINAIPGVVTVGLFAN RGADVALIGTPDGVKTIVK


    Database link: P0A7ZO

  • General notes

     This product was previously labelled as RPIA

     

Properties

Applications

Our Abpromise guarantee covers the use of ab193545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/600. Predicted molecular weight: 23 kDa.

Target

  • Pathway

    Carbohydrate degradation; pentose phosphate pathway; D-ribose 5-phosphate from D-ribulose 5-phosphate (non-oxidative stage): step 1/1.
  • Involvement in disease

    Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency (RPID) [MIM:608611]. A patient has been described with a deficiency of ribose 5-phosphate isomerase who presented with leukoencephalopathy and peripheral neuropathy. Proton magnetic resonance spectroscopy of the brain revealed a highly elevated level of the polyols ribitol and D-arabitol, which were subsequently also found in high concentrations in body fluids. Deficient activity of RPIA, one of the pentose phosphate pathway enzymes, has been demonstrated in fibroblasts.
  • Sequence similarities

    Belongs to the ribose 5-phosphate isomerase family.
  • Information by UniProt
  • Database links

    • Alternative names

      • EC 5.3.1.6 antibody
      • MGC103524 antibody
      • Phosphoriboisomerase A antibody
      • Phosphoriboisomerase antibody
      • Ribose 5 phosphate isomerase antibody
      • ribose 5-phosphate epimerase antibody
      • ribose 5-phosphate isomerase A antibody
      • Ribose-5-phosphate isomerase antibody
      • RPI antibody
      • rpiA antibody
      • RPIA_HUMAN antibody
      • zgc:103524 antibody
      see all

    References

    ab193545 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193545.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up