Overview

  • Product name

  • Description

    Rabbit polyclonal to RPL18
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human RPL18 aa 111-160 (internal sequence). (NP_000970.1)
    Sequence:

    SRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPH


    Database link: Q07020

  • Positive control

    • Human testis tissue, COLO and HeLa cell extracts.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol

    PBS is without Mg2+ and Ca2+
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB 1/500 - 1/1000. Predicted molecular weight: 22 kDa.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testis tissue labeling RPL18 with ab190153 at 10 µg/ml.

  • All lanes : Anti-RPL18 antibody (ab190153) at 1/500 dilution

    Lane 1 : COLO cell extract
    Lane 2 : HeLa cell extract
    Lane 3 : HeLa cell extract with Synthesized peptide.

    Predicted band size: 22 kDa

References

ab190153 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up