Overview

  • Product name

  • Description

    Rabbit polyclonal to RPL19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Dog, Xenopus laevis, Zebrafish, Cynomolgus monkey, Catfish, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human RPL19 aa 79-196.
    Sequence:

    GKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVK GNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQ AKKEEIIKTLSKEEETKK


    Database link: P84098

  • Positive control

    • WB: Mouse spleen tissue lysate. IHC: Human tonsil and endometrial cancer tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000.

Target

Images

  • Anti-RPL19 antibody (ab224592) at 1/500 dilution + Mouse spleen tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Observed band size: 24 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human endometrial cancer tissue stained for RPL19 using ab224592 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for RPL19 using ab224592 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for RPL19 (green) using ab224592 at 1/100 dilution in ICC/IF.

References

ab224592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up