Overview

  • Product name

  • Description

    Rabbit polyclonal to RPL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human RPL4 aa 12-91.
    Sequence:

    SEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQ TSAESWGTGRAVARIPRVRGGGTHRSGQGA


    Database link: P36578

  • Positive control

    • WB: A-375 and HeLa whole cell lysate (ab150035). IHC-P: Human lymph node tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 48 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-RPL4 antibody (ab234829) at 1/500 dilution

    Lane 1 : A-375 (human malignant melanoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat anti-rabbit polyclonal IgG at 1/50000 dilution

    Predicted band size: 48 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling RPL4 (green) using ab234829 at 1/100 dilution in ICC/IF. Secondary antibody was an Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human lymph node tissue stained for RPL4 using ab234829 at 1/100 dilution in immunohistochemical analysis.

References

ab234829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up