Overview

  • Product name
  • Description
    Rabbit polyclonal to RPLP1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Pig, Monkey
  • Immunogen

    Recombinant fragment within Human RPLP1 aa 1-114. The exact sequence is proprietary.
    Sequence:

    MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKA LANVNIGSLI CNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKK EESEESDDDMGFGLFD


    Database link: P05386

  • Positive control
    • Formalin fixed and paraffin embedded Human placenta tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 78% PBS, 1% BSA, 20% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab174789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB Use at an assay dependent concentration. Predicted molecular weight: 12 kDa.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling RPLP1 with ab174789 at 10 µg/ml.

References

ab174789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up