Overview

  • Product name

    Anti-RPP20 antibody
  • Description

    Rabbit polyclonal to RPP20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human RPP20 aa 1-140.
    Sequence:

    MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLA RCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAA NTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK


    Database link: O75817

  • Positive control

    • IHC-P: Human colon and trachea tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.
  • Sequence similarities

    Belongs to the histone-like Alba family.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 0610037N12Rik antibody
    • hPOP7 antibody
    • POP7 (processing of precursor, S. cerevisiae) homolog antibody
    • POP7 antibody
    • POP7_HUMAN antibody
    • processing of precursor 7 ribonuclease P subunit (S. cerevisiae) antibody
    • processing of precursor 7, S. cerevisiae, homolog of antibody
    • Ribonuclease P protein subunit p20 antibody
    • Ribonuclease P, 20-KD subunit antibody
    • Ribonucleases P/MRP protein subunit POP7 homolog antibody
    • RNaseP protein p20 antibody
    • RPP2 antibody
    • RPP20 antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for RPP20 using ab239028 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human trachea tissue stained for RPP20 using ab239028 at 1/100 dilution in immunohistochemical analysis.

References

ab239028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up