Overview

  • Product name

  • Description

    Rabbit polyclonal to RPP29
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human RPP29 aa 1-220.
    Sequence:

    MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQ LQRKAVVLEYFTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFL PLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAIISVTKSKCPSY VGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKF QLRSSERSAKKFKAKGTIDL


    Database link: O95707

  • Positive control

    • IHC-P: Human brain and kidney tissue.
  • General notes

     This product was previously labelled as POP4

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.
  • Cellular localization

    Nucleus; nucleolus
  • Database links

  • Alternative names

    • EC 3.1.26.5 antibody
    • hPOP4 antibody
    • processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae) antibody
    • Ribonuclease P protein subunit p29 antibody
    • RPP29 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for RPP29 using ab23789 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for RPP29 using ab23789 at 1/100 dilution in immunohistochemical analysis.

References

ab234789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up