Overview

  • Product name

  • Description

    Rabbit polyclonal to RPP40
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat RPP40 aa 91-259. N-terminal tags. Expressed in E. coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFMDLSLNLDSKKYRR ISWSFKEKKPLKFDFLLAWHHTGTEESTMMSYFSKYQIREHQPKVALSTV RDLQCPVLQSSSLAGEPEEACNALEFFDWLGAVFCNADLNNEPHNFISTY CCPQPNTVAAQACLCTITGFVLPEKILVLLEQLCHYFDEPKLAPWVTLTV QGFAD


    Database link: Q5BK64-2

  • Positive control

    • IHC-P: Rat spleen tissue. WB: Recombinant rat RPP40 protein. Rat stomach and spleen lysate. HeLa cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded rat spleen tissue stained for RPP40 with ab231621 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-RPP40 antibody (ab231621) at 2 µg/ml + HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
  • Anti-RPP40 antibody (ab231621) at 5 µg/ml + Rat spleen lysate
  • Anti-RPP40 antibody (ab231621) at 2 µg/ml + Rat stomach lysate
  • Anti-RPP40 antibody (ab231621) at 2 µg/ml + Recombinant rat RPP40 protein

References

ab231621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up