Overview

  • Product name
  • Description
    Rabbit polyclonal to RPS14
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide within Human RPS14 aa 101-150 (internal sequence). The exact sequence is proprietary. Numbering is based off mature sequence.
    Sequence:

    GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL


    Database link: P62263

  • Positive control
    • HepG2 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab50390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 17 kDa (predicted molecular weight: 17 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-RPS14 antibody (ab50390) at 2.5 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 17 kDa
    Observed band size: 17 kDa



    Diluted at 2.5µg/ml in 5% skim milk / PBS buffer, gel concentration 15%

References

This product has been referenced in:
  • Gaire J  et al. PrismPlus: a mouse line expressing distinct fluorophores in four different brain cell types. Sci Rep 8:7182 (2018). Read more (PubMed: 29739975) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab50390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up